Property Summary

NCBI Gene PubMed Count 27
Grant Count 43
R01 Count 39
Funding $2,451,096.37
PubMed Score 71.06
PubTator Score 112.77

Knowledge Summary

Patent (15,856)

TINX Plot

  Disease Relevance (3)

Gene RIF (16)

PMID Text
26223677 melanocortin receptors MC2R, MC3R and MC5R are most abundantly expressed in glandular epithelium of the endometrium
25860801 MC2R and MC1R signals are consecutively required for the regulation of EPO signal transduction in erythroblast differentiation, and MC5R signal transduction is required to induce enucleation.
23414113 D115 and D119 in TM3, F195 in TM5, and F254 in TM6 may form a binding pocket for NDP-alpha-MSH binding.
22871966 Melanocortin 5 receptor signaling and internalization: role of MAPK/ERK pathway and beta-arrestins 1/2.
21602033 Data suggest that antagonists of MC1R and MC5R could be effective inhibitors of sebaceous gland differentiation and the production of sebum-specific lipids.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19502010 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19428994 MC5R signals through a PI3K-regulated Akt-independent pathway leading to downstream activation of ERK1/2
More...

AA Sequence

MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGAIVKNKNLHSP      1 - 70
MYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDSMICISVVASMCSLLAIAVDR     71 - 140
YVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILYSESTYVILCLISMFFAMLFLLVSLYIHMFL    141 - 210
LARTHVKRIAALPGASSARQRTSMQGAVTVTMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMY    211 - 280
LILIMCNSVMDPLIYAFRSQEMRKTFKEIICCRGFRIACSFPRRD                             281 - 325
//

Text Mined References (28)

PMID Year Title
26223677 2015 Expression of melanocortin receptors in human endometrium.
25860801 2015 Melanocortins contribute to sequential differentiation and enucleation of human erythroblasts via melanocortin receptors 1, 2 and 5.
23414113 2013 Molecular characterization of human melanocortin-5 receptor ligand-receptor interaction.
22871966 2012 Melanocortin 5 receptor signaling and internalization: role of MAPK/ERK pathway and ?-arrestins 1/2.
21602033 2011 A melanocortin receptor 1 and 5 antagonist inhibits sebaceous gland differentiation and the production of sebum-specific lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19502010 2009 Two complex genotypes relevant to the kynurenine pathway and melanotropin function show association with schizophrenia and bipolar disorder.
19428994 2009 Melanocortin 5 receptor activates ERK1/2 through a PI3K-regulated signaling mechanism.
More...