Property Summary

Ligand Count 82
NCBI Gene PubMed Count 28
PubMed Score 75.22
PubTator Score 112.77

Knowledge Summary

Patent (15,856)

TINX Plot

  Disease (5)

Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160
Disease Target Count
Erythropoietic protoporphyria 15
Disease Target Count P-value
adult high grade glioma 3801 2.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Obesity 678 3.836 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma 1.100 2.6e-03

Gene RIF (17)

AA Sequence

MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGAIVKNKNLHSP      1 - 70
MYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDSMICISVVASMCSLLAIAVDR     71 - 140
YVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILYSESTYVILCLISMFFAMLFLLVSLYIHMFL    141 - 210
LARTHVKRIAALPGASSARQRTSMQGAVTVTMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMY    211 - 280
LILIMCNSVMDPLIYAFRSQEMRKTFKEIICCRGFRIACSFPRRD                             281 - 325
//

Text Mined References (29)

PMID Year Title