Property Summary

NCBI Gene PubMed Count 37
PubMed Score 64.01
PubTator Score 47.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 1.1e-03
Astrocytoma, Pilocytic 1.300 4.7e-06
glioblastoma 1.200 9.9e-03
interstitial cystitis 1.200 3.4e-02
invasive ductal carcinoma 1.511 3.4e-04
lung carcinoma -1.800 7.5e-18
osteosarcoma -1.926 1.8e-04
primary Sjogren syndrome 1.100 1.0e-03
subependymal giant cell astrocytoma 1.584 3.3e-02
tuberculosis -1.100 1.2e-03
ulcerative colitis 1.700 2.0e-03

Synonym

Accession P32971 O43404
Symbols CD153
CD30L
CD30LG
TNLG3A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (23)

AA Sequence

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN      1 - 70
SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF     71 - 140
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT    141 - 210
FQYIDTSTFPLENVLSIFLYSNSD                                                  211 - 234
//

Text Mined References (37)

PMID Year Title