Property Summary

NCBI Gene PubMed Count 36
Grant Count 26
R01 Count 15
Funding $1,271,002.77
PubMed Score 62.94
PubTator Score 47.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -1.926 0.000
glioblastoma 1.200 0.010
tuberculosis -1.400 0.000
interstitial cystitis 1.200 0.034
adult high grade glioma 1.100 0.001
pilocytic astrocytoma 1.200 0.000
primary Sjogren syndrome 1.100 0.001
subependymal giant cell astrocytoma 1.584 0.033
invasive ductal carcinoma 1.511 0.000
lung carcinoma -1.800 0.000
ulcerative colitis 1.700 0.002

Gene RIF (22)

PMID Text
25320285 TNFSF8 is an important leprosy T1R susceptibility gene.
25059065 soluble apoptosis markers as sFas-L, Caspase-9, Caspase-8 and sCD153 were significantly higher in stage III obesity patients compared obese patients without food allergy
24676358 The heritability of IgA levels is moderate and can partly be attributable to common variation in the CD30L locus.
24447865 circulant sCD30L is functionally active and that it may favor persistence of active inflammation by inducing apoptosis of CD30(+)T cells, known to down-modulate inflammation in rheumatoid synovitis.
23333304 HIV-1 Vif upregulates the expression of tumor necrosis factor ligand superfamily, member 8 (TNFSF8) in Vif-expression T cells
22628304 a novel and unexpected role for CD30/CD30L that contributes to proinflammatory immune responses
22033252 The TNFSF8 polymorphisms rs927374 and rs2295800 were associated with neutrophil count. This finding suggests that post-MI inflammatory response is genetically modulated.
21480186 Positional candidate gene screening in the SPA2 locus allowed us to identify and replicate an association between a rare SNP located in TNFSF8 and spondylarthritis.
21292647 a possible role of novel TNFSF8 variants in susceptibility to lung cancer.
20568250 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN      1 - 70
SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF     71 - 140
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT    141 - 210
FQYIDTSTFPLENVLSIFLYSNSD                                                  211 - 234
//

Text Mined References (36)

PMID Year Title
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
25320285 2015 Association of TNFSF8 regulatory variants with excessive inflammatory responses but not leprosy per se.
25059065 2014 [Soluble apoptosis markers in obese patients with food intolerance].
24676358 2014 IgA measurements in over 12 000 Swedish twins reveal sex differential heritability and regulatory locus near CD30L.
24447865 2014 In rheumatoid arthritis soluble CD30 ligand is present at high levels and induces apoptosis of CD30(+)T cells.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22628304 2012 A novel role for reciprocal CD30-CD30L signaling in the cross-talk between natural killer and dendritic cells.
22033252 2011 Association of TNFSF8 polymorphisms with peripheral neutrophil count.
21480186 2011 Systematic candidate gene investigations in the SPA2 locus (9q32) show an association between TNFSF8 and susceptibility to spondylarthritis.
More...