Property Summary

NCBI Gene PubMed Count 75
Grant Count 90
R01 Count 41
Funding $7,440,310.83
PubMed Score 209.12
PubTator Score 146.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma 1.080 0.001
inflammatory breast cancer 1.100 0.035

Synonym

Accession P32970 B4DPR8 Q53XX4 Q96J57
Symbols CD27L
CD27-L
CD27LG
TNFSF7
TNLG8A

Gene

Gene RIF (48)

PMID Text
26671750 Both monomeric and trimeric forms of CD70 were detected in tumour cell membrane fractions, whereas cytoplasmic fractions contained almost exclusively monomeric CD70
26213107 CD70: An emerging target in cancer immunotherapy
24684541 CD70-blocking of alphaDC1s from both controls and patients with chronic lymphocytic leukaemia had a negative influence on the production of both IL-12p70 and the Th1 cytokine IFN-gamma.
24238281 CD70 is overexpressed in systemic lupus erythematosus CD4+ T cells, but expression is not linked to the typical clinical and serological parameters associated with the disease.
23576505 These results highlight the importance of the CD27-CD70 costimulation pathway for the development of CMV-specific T cell immunity during acute and persistent infection.
23206232 CD70 acts as a functional receptor binding to soluble CD27, resulting in lymphoma progression and that immunotherapy using anti-CD70 antibody may be a potential candidate for treatment for NNKTL.
22401771 The mean expression of CD70 was almost twice as high in renal cell carcinoma relative to normal kidney tissue
22399187 These results indicate that CD27 and CD70 gene polymorphisms may affect the risk of breast cancer and show that some SNPs are associated with breast cancer characteristics in a northern Chinese population.
22377764 Regulation of Langerhans cell CD70 expression is important in enhancing immunity against cutaneous epithelial pathogens and cancer.
22306512 Findings suggest that demethylation of CD70 promoter region contributes to the overexpression of CD70 in CD4+ T cells and may contribute to autoimmune response in systemic sclerosis (SSc).
More...

AA Sequence

MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD      1 - 70
PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI     71 - 140
SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP                     141 - 193
//

Text Mined References (78)

PMID Year Title
26671750 2016 Melanoma-expressed CD70 is involved in invasion and metastasis.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26213107 2015 CD70: An emerging target in cancer immunotherapy.
24684541 2014 High functional CD70 expression on ?-type 1-polarized dendritic cells from patients with chronic lymphocytic leukaemia.
24238281 Clinical and serological findings associated with the expression of ITGAL, PRF1, and CD70 in systemic lupus erythematosus.
23576505 2013 CD27-CD70 costimulation controls T cell immunity during acute and persistent cytomegalovirus infection.
23206232 2013 Expression of CD70 in nasal natural killer/T cell lymphoma cell lines and patients; its role for cell proliferation through binding to soluble CD27.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22401771 2012 CD70 expression patterns in renal cell carcinoma.
22399187 2012 Association of CD27 and CD70 gene polymorphisms with risk of sporadic breast cancer in Chinese women in Heilongjiang Province.
More...