Property Summary

NCBI Gene PubMed Count 80
PubMed Score 225.13
PubTator Score 146.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.8e-06
osteosarcoma 7950 6.4e-04
inflammatory breast cancer 286 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer 1.100 3.5e-02
malignant mesothelioma 1.100 3.8e-06
osteosarcoma 1.080 6.4e-04

Gene RIF (53)

AA Sequence

MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQD      1 - 70
PRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSI     71 - 140
SLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP                     141 - 193
//

Text Mined References (83)

PMID Year Title