Property Summary

NCBI Gene PubMed Count 21
PubMed Score 76.80
PubTator Score 48.58

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATV      1 - 70
RTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQ     71 - 140
KDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE                      141 - 192
//

Text Mined References (28)

PMID Year Title