Property Summary

NCBI Gene PubMed Count 69
Grant Count 71
R01 Count 37
Funding $13,601,995.78
PubMed Score 450.14
PubTator Score 90.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Gene

CTH

PANTHER Protein Class (1)

PDB

2NMP   3COG   3ELP  

Gene RIF (58)

PMID Text
26772887 Our study demonstrates that CSE/H2S system is regulated by miR-216a, and regulates ABCA1-mediated cholesterol efflux and cholesterol levels through the PI3K/AKT pathway.
26727544 Collectively, our findings indicate that radiation could promote HCC cell invasion through EMT mediated by endogenous H2S/CSE signaling via the p38MAPK pathway.
26620565 Nox4 is a positive transcriptional regulator of cystathionine-gamma-lyase in endothelial cells.
26519030 3-Mercaptopyruvate sulphurtransferase and not cystathionine gamma-lyase is the primary regulator of coronary artery hydrogen sulfide production and function.
26060478 The expression of CSE was positively correlated with the severity of gastric ulcer
25934094 GPBAR1 plays a role in secondary bile acid induced vasodilation via reglation of cystathionine gamma-lyase. The GPBAR1/CSE pathway might contribute to endothelial dysfunction and hyperdynamic circulation in liver cirrhosis.
25807836 CTH observed relationship between the rs482843 polymorphism and the risk of preeclampsia.
25801727 An increase of placental mRNA levels in the pre-eclampsia group was observed for methionine synthase and cystathionine gamma-lyase.
25486189 Substantial portion of Huntington's disease neurotoxicity appears to be attributable to cystathionine gamma-lyase deficiency.
25205294 The l-cysteine/cystathionine gamma lyase/hydrogen sulfide pathway is involved in melanoma progression.
More...

AA Sequence

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC      1 - 70
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI     71 - 140
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA    141 - 210
TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL    211 - 280
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL    281 - 350
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS                   351 - 405
//

Text Mined References (72)

PMID Year Title
26772887 2016 Cystathionine ?-lyase(CSE)/hydrogen sulfide system is regulated by miR-216a and influences cholesterol efflux in macrophages via the PI3K/AKT/ABCA1 pathway.
26727544 2016 Radiation Exposure Promotes Hepatocarcinoma Cell Invasion through Epithelial Mesenchymal Transition Mediated by H2S/CSE Pathway.
26620565 2016 Transcriptional Regulation of Cystathionine-?-Lyase in Endothelial Cells by NADPH Oxidase 4-Dependent Signaling.
26519030 2016 MPST but not CSE is the primary regulator of hydrogen sulfide production and function in the coronary artery.
26060478 2014 Correlation between the cystathionine-?-lyase (CES) and the severity of peptic ulcer disease.
25934094 2015 Cystathionine ?-lyase, a H2S-generating enzyme, is a GPBAR1-regulated gene and contributes to vasodilation caused by secondary bile acids.
25807836 2015 The importance of rs1021737 and rs482843 polymorphisms of cystathionine gamma-lyase in the etiology of preeclampsia in the Caucasian population.
25801727 2015 The importance of MTHFR, MTR, MTRR and CSE expression levels in Caucasian women with preeclampsia.
25486189 2014 Neurodegeneration in Huntington's disease involves loss of cystathionine ?-lyase.
25416956 2014 A proteome-scale map of the human interactome network.
More...