Property Summary

Ligand Count 4
NCBI Gene PubMed Count 74
PubMed Score 467.83
PubTator Score 90.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -3.172 2.0e-15
adult high grade glioma -1.200 2.4e-03
Astrocytoma, Pilocytic -1.100 3.3e-04
gastric carcinoma -1.200 7.2e-03
group 3 medulloblastoma -1.100 1.2e-02
interstitial lung disease -1.600 7.2e-03
malignant mesothelioma 3.100 8.3e-09
MYELODYSPLASTIC SYNDROME -1.800 4.6e-02
oligodendroglioma -1.100 5.0e-02
pancreatic cancer -1.300 5.6e-03
pancreatic ductal adenocarcinoma liver m... -2.313 5.5e-04
tuberculosis -2.300 3.5e-07
X-linked cerebral adrenoleukodystrophy 2.200 4.2e-02

Protein-protein Interaction (1)

Gene RIF (63)

AA Sequence

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC      1 - 70
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI     71 - 140
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA    141 - 210
TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL    211 - 280
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL    281 - 350
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS                   351 - 405
//

Text Mined References (77)

PMID Year Title