Property Summary

Ligand Count 1
NCBI Gene PubMed Count 92
PubMed Score 24.85
PubTator Score 123.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.400 1.0e-03
Astrocytoma, Pilocytic 1.200 1.4e-05
chronic rhinosinusitis 1.078 2.6e-02
colon cancer -1.900 4.0e-02
cutaneous lupus erythematosus 1.700 6.2e-03
dermatomyositis 1.100 2.0e-02
glioblastoma 1.100 7.3e-04
interstitial cystitis 2.800 3.7e-04
intraductal papillary-mucinous carcinoma... -1.700 2.7e-03
invasive ductal carcinoma 1.092 1.5e-02
lung adenocarcinoma -1.160 1.5e-03
lung cancer -3.800 5.6e-06
lung carcinoma -1.600 4.3e-22
malignant mesothelioma -3.900 9.6e-08
non-small cell lung cancer -1.336 1.1e-10
osteosarcoma -1.797 3.6e-02
ovarian cancer -2.800 3.7e-09
periodontitis 1.200 1.1e-31
primary Sjogren syndrome 2.900 1.1e-06
psoriasis 1.100 3.4e-03
ulcerative colitis 4.200 1.5e-08
Waldenstrons macroglobulinemia -1.312 4.8e-02

 CSPA Cell Line (3)

Protein-protein Interaction (2)

Gene RIF (37)

AA Sequence

MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLL      1 - 70
EPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQ     71 - 140
ISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVA    141 - 210
RVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKP    211 - 280
SPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKD    281 - 350
GDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG    351 - 420
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPNPSKSHLFQNG    421 - 490
SAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIEDPKHVCDPPSGPDTTPAASD    491 - 560
LPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLEYLC    561 - 630
LPAGGQVQLVPLAQAMGPGQAVEVERRPSQGAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSG    631 - 700
DTEDPGVASGYVSSADLVFTPNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELP    701 - 770
PIEGRSPRSPRNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS    771 - 840
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC                 841 - 897
//

Text Mined References (94)

PMID Year Title