Property Summary

NCBI Gene PubMed Count 89
Grant Count 16
R01 Count 6
Funding $1,244,959.85
PubMed Score 23.06
PubTator Score 123.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.312 0.048
malignant mesothelioma -3.900 0.000
cutaneous lupus erythematosus 1.700 0.006
psoriasis 1.100 0.003
osteosarcoma -1.797 0.036
glioblastoma 1.100 0.001
periodontitis 1.200 0.000
non-small cell lung cancer -1.336 0.000
intraductal papillary-mucinous carcinoma... -1.700 0.003
colon cancer -1.900 0.040
lung cancer -4.400 0.000
interstitial cystitis 2.900 0.000
adult high grade glioma 1.400 0.001
pilocytic astrocytoma 1.200 0.000
primary Sjogren syndrome 2.900 0.000
invasive ductal carcinoma 1.092 0.015
lung adenocarcinoma -1.160 0.002
lung carcinoma -1.600 0.000
ulcerative colitis 4.200 0.000
ovarian cancer -2.800 0.000
chronic rhinosinusitis 1.078 0.026
dermatomyositis 1.100 0.020

 GWAS Trait (1)

Gene RIF (34)

PMID Text
23572530 VitD-mediated stimulation of GC anti-inflammatory affects human monocytes in a process involving GM-CSF and MED14
23108143 These data suggest that expression of GM-CSF and its receptor subunits by colon tumors may be a useful marker for prognosis
22935703 This study reveals a novel functional role of clathrin-coated structure in GMR signaling and the oncogenesis of JAK2V617F.
21965659 JAK kinase binding to betac requires the presence of three critical betac lysine residues, and this binding event is essential for receptor ubiquitination, endocytosis, and signaling.
21247258 The results of the study support CSF2RB as a risk factor common to both schizophrenia and major depression in the Chinese Han population.
21207215 the up-regulation of IL-3Rbeta expression may contribute to the maintenance of proliferation rather than cell differentiation.
21205713 Hereditary pulmonary alveolar proteinosis caused by recessive CSF2RB mutations [case report]
21176354 Over expression of IL-3Ralpha and truncated mutation of hbetac may be involved in proliferation and differentiation block in NB4 cells.
21071541 Observational study of gene-disease association. (HuGE Navigator)
20802515 The beta1 integrin-interacting domain in the extracellular domain of IL-3Rbeta was identified. A fragment of a protein corresponding to domain 4 of IL-3Rbeta prevented IL-3-mediated arterial morphogenesis and endothelial cell migration.
More...

AA Sequence

MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLL      1 - 70
EPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQ     71 - 140
ISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVA    141 - 210
RVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKP    211 - 280
SPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKD    281 - 350
GDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG    351 - 420
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPNPSKSHLFQNG    421 - 490
SAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIEDPKHVCDPPSGPDTTPAASD    491 - 560
LPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLEYLC    561 - 630
LPAGGQVQLVPLAQAMGPGQAVEVERRPSQGAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSG    631 - 700
DTEDPGVASGYVSSADLVFTPNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELP    701 - 770
PIEGRSPRSPRNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS    771 - 840
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC                 841 - 897
//

Text Mined References (91)

PMID Year Title
23572530 2013 Vitamin D enhances glucocorticoid action in human monocytes: involvement of granulocyte-macrophage colony-stimulating factor and mediator complex subunit 14.
23108143 2013 Immune-dependent and independent antitumor activity of GM-CSF aberrantly expressed by mouse and human colorectal tumors.
22935703 2012 Identification of a novel function of the clathrin-coated structure at the plasma membrane in facilitating GM-CSF receptor-mediated activation of JAK2.
22138694 2011 A genome-wide association study in Han Chinese identifies new susceptibility loci for ankylosing spondylitis.
21965659 2011 Three lysine residues in the common ? chain of the interleukin-5 receptor are required for Janus kinase (JAK)-dependent receptor ubiquitination, endocytosis, and signaling.
21247258 2011 Common SNPs in CSF2RB are associated with major depression and schizophrenia in the Chinese Han population.
21207215 2011 Down-regulating the expression of IL-3R? interfered with the proliferation, not differentiation in NB4 cells.
21205713 2011 Hereditary pulmonary alveolar proteinosis caused by recessive CSF2RB mutations.
21176354 2010 [Expression change of IL-3 receptor system in all-trans retinoic acid induced differentiation of NB4 cells].
21075760 2011 Adult-onset hereditary pulmonary alveolar proteinosis caused by a single-base deletion in CSF2RB.
More...