Property Summary

NCBI Gene PubMed Count 22
PubMed Score 22.21
PubTator Score 95.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
St. Louis encephalitis 5 4.715 2.4

Protein-protein Interaction (7)

Gene RIF (59)

AA Sequence

MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQ      1 - 70
FQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSI     71 - 140
LAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE                         141 - 189
//

Text Mined References (24)

PMID Year Title