Property Summary

NCBI Gene PubMed Count 82
PubMed Score 41.92
PubTator Score 34.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
ovarian cancer 8492 4.02782867794024E-9
hepatocellular carcinoma 550 1.98596428355439E-5
tuberculosis and treatment for 6 months 686 4.26977891411796E-4
pancreatic cancer 2300 0.00398776656527724
pancreatic carcinoma 567 0.00398776656527732
gastric cancer 436 0.00591937370385294
Waldenstrons macroglobulinemia 765 0.0237290384442598

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 0.006
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.200 0.004
Waldenstrons macroglobulinemia 1.017 0.024
tuberculosis and treatment for 6 months -2.300 0.000
pancreatic carcinoma 1.200 0.004
ovarian cancer -2.200 0.000

Synonym

Accession P32780 B3KXE0 D3DQY2 Q6I9Y7 Q9H5K5 Q9NQD9
Symbols P62
BTF2
TFB1
TFIIH

Gene

PANTHER Protein Class (1)

PDB

2RUK   2RVB   2RNR   1PFJ   2DII  

  Ortholog (13)

 GO Function (1)

Gene RIF (31)

PMID Text
24403578 Virulence factor NSs of rift valley fever virus recruits the FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
21543505 These data suggest that the RVFV NSs protein is able to interact with the TFIIH subunit p62 inside infected cells and promotes its degradation, which can occur directly in the nucleus.
21489275 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
20974803 cdk1 phosphorylates p62 in vitro and in vivo at T269 and S272, which is necessary for the maintenance of appropriate cyclin B1 levels and the levels of cdk1 activity necessary to allow cells to properly enter and exit mitosis.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of general transcription factor IIH, polypeptide 1 (GTF2H1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18692935 GTF2H1 polymorphisms/haplotypes may contribute to genetic susceptibility to lung cancer.
18692935 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLH      1 - 70
AGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAE     71 - 140
EFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAEN    141 - 210
VPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEG    211 - 280
YGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVK    281 - 350
RAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ    351 - 420
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKV    421 - 490
VKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT                491 - 548
//

Text Mined References (87)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24403578 2014 Virulence factor NSs of rift valley fever virus recruits the F-box protein FBXO3 to degrade subunit p62 of general transcription factor TFIIH.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
21543505 2011 NSs protein of rift valley fever virus promotes posttranslational downregulation of the TFIIH subunit p62.
21269460 2011 Initial characterization of the human central proteome.
21124955 2010 Genome-wide association study identifies two novel regions at 11p15.5-p13 and 1p31 with major impact on acute-phase serum amyloid A.
20974803 2011 Phosphorylation of p62 by cdk1 controls the timely transit of cells through mitosis and tumor cell proliferation.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
More...