Property Summary

Ligand Count 77
NCBI Gene PubMed Count 18
PubMed Score 452.83
PubTator Score 94.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 3.7e-03
ependymoma 1.100 4.0e-03
malignant mesothelioma -2.100 2.3e-06
nephrosclerosis -2.596 1.7e-02
osteosarcoma -1.107 4.5e-03

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFV      1 - 70
LSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYG     71 - 140
DTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFW    141 - 210
SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH    211 - 280
LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV    281 - 350
IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM                               351 - 393
//

Text Mined References (22)

PMID Year Title