Property Summary

Ligand Count 232
NCBI Gene PubMed Count 62
PubMed Score 68.55
PubTator Score 62.31

Knowledge Summary

Patent (9,002)

TINX Plot

 GWAS Trait (1)

Gene RIF (40)

AA Sequence

MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLLGNSLVIYVVL      1 - 70
RHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVD     71 - 140
RYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYT    141 - 210
AALGFFGPLLVICLCYLLIVVKVRSAGRRVWAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVN    211 - 280
VVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEE    281 - 350
EDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL      351 - 418
//

Text Mined References (63)

PMID Year Title