Property Summary

NCBI Gene PubMed Count 61
PubMed Score 67.00
PubTator Score 62.31

Knowledge Summary

Patent (9,002)

Synonym

Accession P32745 A8K550 Q53ZR7 SS-3-R
Symbols SS3R
SS3-R
SS-3-R
SSR-28

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

 GWAS Trait (1)

Gene RIF (39)

PMID Text
26474434 Data showed that the distribution of somatostatin receptor (SSTR) subtypes among the 199 pancreatic neuroendocrine tumors (PNETs) was: SSTR2 (54.8%), SSTR1 (53.3%), SSTR4 (51.8%), SSTR5 (33.7%), and SSTR3 (28.6%).
26112183 findings provide new insights in understanding the antiproliferative role of SSTR3 in breast tumor biology.
25962406 An immunohistochemical investigation of the expression of somatostatin receptor subtypes
25808161 Data indicate that somatostatin receptor scintigraphy (SRS) and immunohistochemical results for somatostatin and dopamine receptors sstr2, sstr3, sstr5 and D2R were compared in neuroendocrine neoplasms tissues.
25554089 SSTR2A and SSTR3 are more likely to be expressed in SDH-deficient pheochromocytomas/paragangliomas compared with tumors demonstrating normal SDHB staining pattern.
25536318 In conclusions, in CNFAs, high expression of somatostatin receptors is much less common than that of D2R
24606125 constitutive SSTR3 activity mediates transcriptional repression of GH.
23991955 High SSTR3 expression is associated with gallbladder cancer.
22419713 Determination of the expression of SSTR3 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas.
21503779 mRNA levels of SSTR2a, SSTR3 and SSTR5 in neuroendocrine lung cancer affected patients, were determined
More...

AA Sequence

MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLLGNSLVIYVVL      1 - 70
RHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVD     71 - 140
RYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYT    141 - 210
AALGFFGPLLVICLCYLLIVVKVRSAGRRVWAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVN    211 - 280
VVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEE    281 - 350
EDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL      351 - 418
//

Text Mined References (62)

PMID Year Title
26474434 2016 Prognostic Value of Somatostatin Receptor Subtypes in Pancreatic Neuroendocrine Tumors.
26112183 2015 Human somatostatin receptor-3 distinctively induces apoptosis in MCF-7 and cell cycle arrest in MDA-MB-231 breast cancer cells.
25962406 2015 An immunohistochemical investigation of the expression of somatostatin receptor subtypes - should therapeutic trials be performed to determine the efficacy of somatostatin analogs in treating advanced thyroid malignances?
25808161 2015 Somatostatin and dopamine receptor expression in neuroendocrine neoplasms: correlation of immunohistochemical findings with somatostatin receptor scintigraphy visual scores.
25554089 2015 Increased SSTR2A and SSTR3 expression in succinate dehydrogenase-deficient pheochromocytomas and paragangliomas.
25536318 2015 Dopamine 2 and somatostatin 1-5 receptors coexpression in clinically non-functioning pituitary adenomas.
24606125 2014 Constitutive somatostatin receptor subtype-3 signaling suppresses growth hormone synthesis.
23991955 2013 Somatostatin receptors 3, 4 and 5 play important roles in gallbladder cancer.
22651821 2012 Coexpression of human somatostatin receptor-2 (SSTR2) and SSTR3 modulates antiproliferative signaling and apoptosis.
22419713 2012 Expression of Ki-67, PTTG1, FGFR4, and SSTR 2, 3, and 5 in nonfunctioning pituitary adenomas: a high throughput TMA, immunohistochemical study.
More...