Property Summary

NCBI Gene PubMed Count 39
PubMed Score 5.73
PubTator Score 69.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.060 1.7e-02
astrocytic glioma 1.400 2.4e-03
Astrocytoma, Pilocytic 1.500 1.5e-06
ependymoma 1.100 1.5e-02
glioblastoma 1.100 9.4e-05
intraductal papillary-mucinous adenoma (... 1.200 7.4e-03
juvenile dermatomyositis 1.040 4.7e-10
lung cancer -1.400 3.8e-03
oligodendroglioma 1.100 1.3e-02
ovarian cancer -1.300 4.8e-05
pediatric high grade glioma 1.100 2.1e-04
primary Sjogren syndrome 1.300 1.2e-04
Rheumatoid arthritis 1.800 2.1e-03
subependymal giant cell astrocytoma 1.598 3.9e-03
Waldenstrons macroglobulinemia 1.021 2.5e-02

Protein-protein Interaction (1)

Gene RIF (17)

AA Sequence

MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAE      1 - 70
EEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRINNNIFSSPEDDMVVAPVTHV     71 - 140
SVTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYL    141 - 210
WEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKV    211 - 280
EGQRLVYQFKEMPKDLIYINDEDPSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNS    281 - 350
KAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRT    351 - 420
IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQK    421 - 490
AGSPPSIVLGPAQVQQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPRSSQLVAHPPGTVITSVIKTQ    491 - 560
ETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAMKQNELLEPNSF               561 - 619
//

Text Mined References (49)

PMID Year Title