Property Summary

NCBI Gene PubMed Count 39
Grant Count 68
R01 Count 41
Funding $5,962,448.59
PubMed Score 5.73
PubTator Score 69.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P32519 B4E2I5 E9PDQ9 Q8N6F6 Q9UDE1
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (17)

PMID Text
26643049 ELF-1 binds an important duplicated GGAA cis-acting element at the OAS1 promoter and in cooperation with RB1 and SP1 recruitment contributes to regulation in response to IFN stimulation.
26553150 ELF1 binding occurs at both TERT promoter mutations in melanoma in vitro such that increased recruitment of GABP is enabled by the spatial architecture of native and novel ETS motifs in the TERT promoter region.
21931859 Expression of FLI-1, ELF-1, and GABP activated the PF4 promoter in HepG2 cells.
21867680 the results indicate that insufficient O-GlcNAc modification prevents Elf-1-mediated transcriptional repression and thereby upregulates Tollip gene expression in intestinal epithelial cells.
21811762 Data suggest that Elf-1 may modulate breast cancer progression to some extent without having an impact on survival of breast cancer patients.
21044949 through a genome-wide association in a Hong Kong Chinese cohort and replication in 2 other Asian populations, identified association of ELF1 with systemic lupus erythematosus
21044949 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20600580 ETS transcription factor ELF1 is an important positive regulator of MEIS1 expression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346215 The expression of Elf-1 and survivin in non-small cell lung cancer is related to differentiation, lymphatic metastasis, clinical stage, and prognosis, and both are positively correlated with microvessel density.
More...

AA Sequence

MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAE      1 - 70
EEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRINNNIFSSPEDDMVVAPVTHV     71 - 140
SVTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYL    141 - 210
WEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKV    211 - 280
EGQRLVYQFKEMPKDLIYINDEDPSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNS    281 - 350
KAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRT    351 - 420
IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQK    421 - 490
AGSPPSIVLGPAQVQQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPRSSQLVAHPPGTVITSVIKTQ    491 - 560
ETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAMKQNELLEPNSF               561 - 619
//

Text Mined References (49)

PMID Year Title
26643049 2015 The hematopoietic regulator, ELF-1, enhances the transcriptional response to Interferon-? of the OAS1 anti-viral gene.
26553150 2016 An interaction proteomics survey of transcription factor binding at recurrent TERT promoter mutations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21931859 2011 Multiple ETS family proteins regulate PF4 gene expression by binding to the same ETS binding site.
21867680 2011 Transcription of the Tollip gene is elevated in intestinal epithelial cells through impaired O-GlcNAcylation-dependent nuclear translocation of the negative regulator Elf-1.
21811762 2011 Protein expression of the Ets transcription factor Elf-1 in breast cancer cells is negatively correlated with histological grading, but not with clinical outcome.
21269460 2011 Initial characterization of the human central proteome.
More...