Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
R01 Count 2
Funding $104,062.5
PubMed Score 26.66
PubTator Score 19.15

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P32456 Q6GPH0 Q6IAU2 Q86TB0
Symbols

Gene

 Grant Application (2)

Gene RIF (11)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of guanylate binding protein 2, interferon-inducible (GBP2) in primary human brain microvascular endothelial cells
23086406 GBP1/2 are critical effectors of antichlamydial interferon (IFN)gamma-mediated pathogen clearance via rerouting of bacterial inclusions in macrophages for lysosomal degradation.
23001506 Low GBP2 expression is associated with metastasis in breast cancer.
22864358 Downregulation of MIR-433 is associated with myeloproliferative neoplasms.
21151871 The in vivo localization of GBP-2 at cellular membranes is regulated by isoprenylation and dimerization.
20923658 hGBP-1, hGBP-2 showed dimerization-related GTPase activity for GMP formation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19912588 Guanylate-binding protein 2 mRNA in peripheral blood leukocytes may have a role in acute cellular rejection after liver transplantation
19003964 GBP-2 is regulated by p53 and may have a role in esophageal squamous cell carcinomas
17517895 Sky1p utilizes the same docking groove to bind yeast SR-like protein Gbp2p and phosphorylates all three serines present in a contiguous RS dipeptide stretch
More...

AA Sequence

MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGST      1 - 70
VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMD     71 - 140
QLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGT    141 - 210
DKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTL    211 - 280
SGGIPVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQE    281 - 350
LLDLHRDSEREAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV    351 - 420
KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVE    421 - 490
RIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQLMAEQEKTLALKLQEQERLLK    491 - 560
EGFENESKRLQKDIWDIQMRSKSLEPICNIL                                           561 - 591
//

Text Mined References (25)

PMID Year Title
23086406 2013 Autophagy restricts Chlamydia trachomatis growth in human macrophages via IFNG-inducible guanylate binding proteins.
23001506 2014 Interferon-inducible guanylate binding protein (GBP2) is associated with better prognosis in breast cancer and indicates an efficient T cell response.
22970192 2012 Suppression of IFN-induced transcription underlies IFN defects generated by activated Ras/MEK in human cancer cells.
22864358 2013 miR-433 is aberrantly expressed in myeloproliferative neoplasms and suppresses hematopoietic cell growth and differentiation.
21151871 2010 Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner.
20923658 2010 Dimerization and its role in GMP formation by human guanylate binding proteins.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19912588 2010 Guanylate-binding protein 2 mRNA in peripheral blood leukocytes of liver transplant recipients as a marker for acute cellular rejection.
19003964 2009 Interferon-inducible guanylate binding protein (GBP)-2: a novel p53-regulated tumor marker in esophageal squamous cell carcinomas.
18985028 2008 Hepatitis C virus infection protein network.
More...