Property Summary

NCBI Gene PubMed Count 21
PubMed Score 31.28
PubTator Score 19.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (35)

Disease log2 FC p
active Crohn's disease 1.986 1.2e-03
active ulcerative colitis 1.330 1.1e-02
acute quadriplegic myopathy 1.537 1.9e-07
adrenocortical carcinoma -1.978 1.5e-03
adult high grade glioma 2.300 3.8e-04
aldosterone-producing adenoma -1.692 2.6e-02
astrocytoma 1.300 1.6e-06
Astrocytoma, Pilocytic 3.200 2.2e-11
autosomal dominant Emery-Dreifuss muscul... 1.014 2.3e-03
Breast cancer -1.700 9.7e-08
chronic kidney disease 1.200 3.4e-02
Chronic Lymphocytic Leukemia 1.357 1.1e-04
colon cancer -1.300 5.2e-03
cystic fibrosis 1.517 4.9e-04
dermatomyositis 2.000 6.2e-03
diabetes mellitus -1.300 1.7e-03
Endometriosis -1.507 7.2e-03
ependymoma 1.500 3.3e-03
gastric carcinoma 1.200 2.3e-02
glioblastoma 1.900 6.6e-05
intraductal papillary-mucinous adenoma (... 1.400 2.6e-03
intraductal papillary-mucinous carcinoma... 1.900 4.9e-03
intraductal papillary-mucinous neoplasm ... 2.000 4.2e-03
juvenile dermatomyositis 2.162 1.2e-12
limb girdle muscular dystrophy 2I 1.202 2.9e-04
lung cancer -1.600 4.2e-04
lung carcinoma -2.600 4.3e-20
non primary Sjogren syndrome sicca -1.100 1.9e-02
ovarian cancer -1.200 2.5e-02
pancreatic cancer 1.200 5.4e-04
pancreatic ductal adenocarcinoma liver m... 1.173 2.0e-02
Pick disease 1.800 4.3e-02
pituitary cancer -1.500 1.7e-04
sarcoidosis 1.400 2.2e-02
subependymal giant cell astrocytoma 4.047 9.6e-04

Protein-protein Interaction (10)

Gene RIF (11)

AA Sequence

MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGST      1 - 70
VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMD     71 - 140
QLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGT    141 - 210
DKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTL    211 - 280
SGGIPVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQE    281 - 350
LLDLHRDSEREAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV    351 - 420
KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVE    421 - 490
RIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQLMAEQEKTLALKLQEQERLLK    491 - 560
EGFENESKRLQKDIWDIQMRSKSLEPICNIL                                           561 - 591
//

Text Mined References (25)

PMID Year Title