Property Summary

NCBI Gene PubMed Count 53
Grant Count 17
R01 Count 12
Funding $1,232,345.17
PubMed Score 111.10
PubTator Score 99.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (44)

PMID Text
26760981 GBP1 promotes lymph node metastasis and has a positive correlation with EGFR expression in esophageal squamous cell carcinoma.
25098609 GBP1 overexpression is necessary for the radioresistant phenotype in clinically relevant radioresistant cells
25081641 Molecular dynamics studies showed that only GTP decreases the formation of the GBP1:PIM1 complex through an allosteric mechanism, outlining the rational for the identification of new compounds potentially able to revert resistance to paclitaxel.
24991938 data show that dimer formation of hGBP1 involves multiple spatially distant regions of the protein, namely, the N-terminal LG domain and the C-terminal helices alpha13.
24337748 GBP-1 is a downstream processor of IFN-gamma.
24190970 GBP-1 is a novel member within the family of actin-remodeling proteins specifically mediating IFN-gamma-dependent defense strategies.
24190970 IFN-gamma-induced Guanylate Binding Protein-1 is a novel Actin Cytoskeleton Remodeling Factor. GBP-1 may induce actin remodeling via globular actin sequestering and/or filament capping. GBP-1 is a novel member within the family of actin remodeling proteins, specifically mediating IFN-gamma-dependent defense strategies.
24162774 HIV-1 gp120 downregulates the expression of interferon-inducible guanylate-binding protein 1 (GBP1) in human B cells
23727578 Data indicate that among three deductive p53 response element (p53RE) present in the hGBP1 promoter region, two p53REs were found to be transactivated by p53.
23086406 GBP1/2 are critical effectors of antichlamydial interferon (IFN)gamma-mediated pathogen clearance via rerouting of bacterial inclusions in macrophages for lysosomal degradation.
More...

AA Sequence

MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGST      1 - 70
VQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMD     71 - 140
QLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKK    141 - 210
GTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTK    211 - 280
TLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETL    281 - 350
QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE    351 - 420
EVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIE    421 - 490
VERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQL    491 - 560
LKEGFQKESRIMKNEIQDLQTKMRRRKACTIS                                          561 - 592
//

Text Mined References (59)

PMID Year Title
26760981 2015 Guanylate-binding protein 1 (GBP1) promotes lymph node metastasis in human esophageal squamous cell carcinoma.
25098609 2014 Guanine nucleotide-binding protein 1 is one of the key molecules contributing to cancer cell radioresistance.
25081641 2015 GTP is an allosteric modulator of the interaction between the guanylate-binding protein 1 and the prosurvival kinase PIM1.
24991938 2014 Triphosphate induced dimerization of human guanylate binding protein 1 involves association of the C-terminal helices: a joint double electron-electron resonance and FRET study.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24190970 2014 Gamma interferon-induced guanylate binding protein 1 is a novel actin cytoskeleton remodeling factor.
23727578 2013 Identification of human guanylate-binding protein 1 gene (hGBP1) as a direct transcriptional target gene of p53.
23086406 2013 Autophagy restricts Chlamydia trachomatis growth in human macrophages via IFNG-inducible guanylate binding proteins.
23042300 2013 GBP-1 acts as a tumor suppressor in colorectal cancer cells.
22859948 2012 Insight into temperature dependence of GTPase activity in human guanylate binding protein-1.
More...