Property Summary

NCBI Gene PubMed Count 60
PubMed Score 126.29
PubTator Score 99.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Influenza, Human 51 0.0 0.0
Disease Target Count
Influenza 142
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Ulceroglandular tularemia 2 4.009 2.0

Expression

  Differential Expression (36)

Disease log2 FC p
active Crohn's disease 3.086 7.1e-05
active ulcerative colitis 1.608 6.9e-03
adult high grade glioma 2.700 4.6e-04
aldosterone-producing adenoma -1.076 1.9e-02
astrocytoma 1.600 5.4e-07
Astrocytoma, Pilocytic 3.000 1.7e-07
Atopic dermatitis 1.100 3.8e-02
cutaneous lupus erythematosus 2.900 3.0e-04
cystic fibrosis 1.300 1.4e-02
dermatomyositis 2.300 1.9e-02
ependymoma 3.100 1.1e-09
esophageal adenocarcinoma 1.400 3.9e-02
glioblastoma 2.100 4.5e-04
hepatocellular carcinoma 1.800 5.6e-04
Hydrolethalus syndrome -1.223 2.8e-02
interstitial cystitis 1.700 9.5e-03
intraductal papillary-mucinous neoplasm ... 2.000 3.0e-02
invasive ductal carcinoma 1.300 9.4e-03
juvenile dermatomyositis 3.457 6.0e-17
limb girdle muscular dystrophy 2I 1.134 4.8e-02
lung cancer -2.700 1.8e-05
malignant mesothelioma -1.900 6.5e-07
Multiple Sclerosis 2.200 2.2e-03
nasopharyngeal carcinoma 1.300 1.2e-03
oligodendroglioma 1.100 1.6e-03
osteosarcoma 1.901 1.2e-03
ovarian cancer 3.900 1.4e-06
pancreatic cancer 1.200 2.3e-03
pancreatic ductal adenocarcinoma liver m... 1.424 5.0e-02
Pick disease 1.900 2.3e-02
pituitary cancer -1.200 2.0e-02
primary Sjogren syndrome 1.900 6.9e-04
psoriasis 1.900 2.2e-07
sarcoidosis 2.000 1.0e-02
subependymal giant cell astrocytoma 2.711 1.6e-02
tuberculosis and treatment for 6 months -1.200 3.9e-02

Gene RIF (51)

AA Sequence

MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGST      1 - 70
VQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMD     71 - 140
QLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKK    141 - 210
GTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTK    211 - 280
TLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETL    281 - 350
QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSALLQVIFSPLEE    351 - 420
EVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIE    421 - 490
VERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQL    491 - 560
LKEGFQKESRIMKNEIQDLQTKMRRRKACTIS                                          561 - 592
//

Text Mined References (66)

PMID Year Title