Property Summary

Ligand Count 294
NCBI Gene PubMed Count 104
PubMed Score 349.13
PubTator Score 621.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -3.600 1.5e-04
astrocytic glioma -2.700 9.7e-04
Astrocytoma, Pilocytic -3.300 2.3e-06
atypical teratoid / rhabdoid tumor -5.300 4.5e-09
colon cancer -1.700 1.4e-05
COPD -1.600 1.3e-03
cystic fibrosis -1.300 5.5e-04
ependymoma -3.400 1.7e-03
glioblastoma -3.500 2.9e-08
group 3 medulloblastoma -2.500 1.4e-02
head and neck cancer -1.600 1.6e-02
Hydrolethalus syndrome 1.395 2.9e-02
intraductal papillary-mucinous adenoma (... -1.200 4.7e-02
intraductal papillary-mucinous carcinoma... -1.500 1.9e-02
intraductal papillary-mucinous neoplasm ... -2.000 2.8e-02
medulloblastoma, large-cell -4.600 2.0e-05
non primary Sjogren syndrome sicca -1.100 2.4e-02
non-small cell lung cancer -1.107 1.6e-13
oligodendroglioma -2.700 2.2e-02
osteosarcoma 1.453 4.6e-02
ovarian cancer -1.500 1.4e-02
pancreatic cancer 1.200 3.6e-03
pancreatic carcinoma 1.200 3.6e-03
Pick disease 1.500 6.1e-03
pituitary cancer 1.900 4.5e-06
primitive neuroectodermal tumor -3.100 9.4e-03
psoriasis -1.100 1.0e-11
tuberculosis 2.100 1.6e-05
ulcerative colitis 1.100 1.5e-07

 CSPA Cell Line (1)

Gene RIF (72)

AA Sequence

MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVILPIWEPQDPS      1 - 70
FGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLM     71 - 140
ALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAW    141 - 210
SIFAYTWLYIILSVISPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEG    211 - 280
DRPSSKTEIEMDGKVVNSHVENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELAN    281 - 350
YQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE    351 - 420
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDEN    421 - 490
FLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKV    491 - 560
LRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPR    561 - 630
LVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE    631 - 700
MGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKL    701 - 770
PSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF    771 - 840
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFS    841 - 910
VTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF           911 - 973
//

Text Mined References (109)

PMID Year Title