Property Summary

NCBI Gene PubMed Count 100
Grant Count 124
R01 Count 105
Funding $13,915,770.29
PubMed Score 236.38
PubTator Score 621.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
pancreatic cancer 1.200 0.004
astrocytic glioma -2.700 0.001
ependymoma -5.000 0.000
oligodendroglioma -2.800 0.000
glioblastoma -4.700 0.000
osteosarcoma -1.489 0.000
medulloblastoma -5.100 0.000
cystic fibrosis -1.300 0.001
atypical teratoid / rhabdoid tumor -5.300 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -3.100 0.009
tuberculosis 2.200 0.000
non-small cell lung cancer -1.107 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.047
intraductal papillary-mucinous carcinoma... -1.500 0.019
intraductal papillary-mucinous neoplasm ... -2.000 0.028
Hydrolethalus syndrome 1.395 0.029
colon cancer -1.700 0.000
pediatric high grade glioma -3.700 0.000
pilocytic astrocytoma -3.200 0.000
non primary Sjogren syndrome sicca -1.100 0.024
pancreatic carcinoma 1.200 0.004
psoriasis -1.400 0.000
COPD -1.600 0.001
Pick disease 1.500 0.006
ulcerative colitis 1.100 0.000
ovarian cancer -1.500 0.014
pituitary cancer 2.400 0.000
head and neck cancer -1.600 0.016

Gene

PANTHER Protein Class (2)

Gene RIF (68)

PMID Text
27031991 The expression of miR-206 by HUVECs reduced exosome production by regulating ADP-Ribosylation Factor 6 (ARF6) and sodium/calcium exchanger 1 (NCX1).
26775040 interaction of NHE1, NCX1 and CaM mediates the effects of IL6 on human hepatocellular carcinoma
26567603 NCX1 operating in reverse mode plays a prominent role in calcium cytosolic regulation in highly metastatic melanoma cells.
26421717 results demonstrate that CaM senses changes in [Ca2+]i and binds to the cytoplasmic loop of NCX1 to regulate exchange activity.
26418956 NCX1.3 is the predominant NCX variant in the distal convoluted and connecting tubules tubules
26045217 ADD2 and NCX1 variants influence the risk and the clinical features of systemic lupus erythematosus and lupus nephritis.
25770213 These data confirm the role of NCX1 activity in regulating renal epithelial cell migration.
25589784 human osteoblasts and osteoblasts from Ano6(-/-) and WT mice, we demonstrate that NCX1 requires Ano6 to efficiently translocate Ca(2+) out of osteoblasts into the calcifying bone matrix
25500693 The expressions of NCX1 and NCKX4 were significantly higher in the patent ductus arteriosus group at both the protein and mRNA levels.
25481039 Down-regulation of the SLC8A1 gene, most likely mediated by its regulator miR-223, can lead to decreased calcium in penile carcinoma and consequently to suppressed apoptosis and increased tumor cell proliferation
More...

AA Sequence

MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVILPIWEPQDPS      1 - 70
FGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETTKTTVRIWNETVSNLTLM     71 - 140
ALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIIIALCVYVVPDGETRKIKHLRVFFVTAAW    141 - 210
SIFAYTWLYIILSVISPGVVEVWEGLLTFFFFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEG    211 - 280
DRPSSKTEIEMDGKVVNSHVENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELAN    281 - 350
YQVLSQQQKSRAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE    351 - 420
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDEN    421 - 490
FLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKV    491 - 560
LRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIGEPR    561 - 630
LVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE    631 - 700
MGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKL    701 - 770
PSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF    771 - 840
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFS    841 - 910
VTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIFFSSLEAYCHIKGF           911 - 973
//

Text Mined References (105)

PMID Year Title
27031991 2016 Endothelial Cells Can Regulate Smooth Muscle Cells in Contractile Phenotype through the miR-206/ARF6&NCX1/Exosome Axis.
26775040 2016 Na+/H+ exchanger 1, Na+/Ca2+ exchanger 1 and calmodulin complex regulates interleukin 6-mediated cellular behavior of human hepatocellular carcinoma.
26567603 2015 Sodium calcium exchanger operates in the reverse mode in metastatic human melanoma cells.
26421717 2015 Calmodulin Interacts with the Sodium/Calcium Exchanger NCX1 to Regulate Activity.
26418956 2015 The Na+/Ca2+ Exchanger 1 (NCX1) Variant 3 as the Major Extrusion System in Renal Distal Tubular Transcellular Ca2+-Transport.
26045217 2015 Beta-adducin and sodium-calcium exchanger 1 gene variants are associated with systemic lupus erythematosus and lupus nephritis.
25770213 2015 Sodium-calcium exchanger 1 regulates epithelial cell migration via calcium-dependent extracellular signal-regulated kinase signaling.
25589784 2015 Anoctamin-6 controls bone mineralization by activating the calcium transporter NCX1.
25500693 2015 Elevated NCX1 and NCKX4 expression in the patent postnatal ductus arteriosus of ductal-dependent congenital heart disease patients.
25481039 2015 Down-Regulation of SLC8A1 as a Putative Apoptosis Evasion Mechanism by Modulation of Calcium Levels in Penile Carcinoma.
More...