Property Summary

NCBI Gene PubMed Count 20
PubMed Score 65.35
PubTator Score 13.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.100 5.3e-03
lung cancer 1.400 4.7e-03
Multiple myeloma 1.829 2.6e-04
osteosarcoma 1.349 2.2e-03
ovarian cancer -2.500 7.8e-09
posterior fossa group B ependymoma 1.200 5.6e-06
psoriasis 1.400 7.3e-03
sonic hedgehog group medulloblastoma 1.300 1.2e-03
Waldenstrons macroglobulinemia 1.114 1.4e-02

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRT      1 - 70
AENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATA     71 - 140
ARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ                                    141 - 178
//

Text Mined References (25)

PMID Year Title