Property Summary

NCBI Gene PubMed Count 16
Grant Count 392
R01 Count 13
Funding $595,533,059.2
PubMed Score 65.13
PubTator Score 13.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.114 0.014
Multiple myeloma 1.926 0.000
psoriasis 3.100 0.000
osteosarcoma 1.861 0.000
glioblastoma 1.100 0.005
lung cancer 1.500 0.000
posterior fossa group B ependymoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.300 0.001
ovarian cancer -2.500 0.000

Synonym

Accession P32321 B2R836 D3DP49 D3DP50 Q5M7Z8 Q9BVD8
Symbols

Gene

PANTHER Protein Class (2)

PDB

2W4L  

 GWAS Trait (1)

Gene RIF (3)

PMID Text
20665488 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17602053 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRT      1 - 70
AENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATA     71 - 140
ARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ                                    141 - 178
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20665488 2010 Gemcitabine metabolic and transporter gene polymorphisms are associated with drug toxicity and efficacy in patients with locally advanced pancreatic cancer.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
More...