Property Summary

Ligand Count 15
NCBI Gene PubMed Count 84
PubMed Score 515.16
PubTator Score 968.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Cancer 2499 4.259 2.1
Bloom syndrome 29 3.147 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
esophageal adenocarcinoma -2.500 1.9e-02
gastric cancer -1.400 4.4e-03
interstitial cystitis 1.100 5.1e-05
mucosa-associated lymphoid tissue lympho... 2.183 2.5e-02
osteosarcoma -3.691 1.2e-04
pancreatic cancer 1.100 1.4e-04
psoriasis -1.600 1.9e-03
tuberculosis 1.300 2.7e-04

Protein-protein Interaction (10)

Gene RIF (71)

AA Sequence

MAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTA      1 - 70
IQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPE     71 - 140
DLQKTQ                                                                    141 - 146
//

Text Mined References (84)

PMID Year Title