Property Summary

NCBI Gene PubMed Count 83
Grant Count 278
R01 Count 132
Funding $42,874,941.23
PubMed Score 503.13
PubTator Score 968.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.400 0.004
esophageal adenocarcinoma -2.500 0.019
psoriasis -1.600 0.002
osteosarcoma -3.691 0.000
tuberculosis 1.300 0.000
pancreatic cancer 1.100 0.000
interstitial cystitis 1.100 0.000
mucosa-associated lymphoid tissue lympho... 2.183 0.025

Synonym

Accession P32320
Symbols CDD

Gene

CDA

PANTHER Protein Class (2)

PDB

1MQ0  

Gene RIF (71)

PMID Text
26418006 Single nucleotide polymorphisms in cytidine deaminase gene were associated with the efficacy of gemcitabine in Biliary Tract Cancer.
26354033 results indicate that rs2072671 in CDA may be an important prognostic marker in NK-AML patients.
26200337 tumor cell lines that are susceptible to epigenetic nucleosides overexpress cytidine deaminase (CDA); CDA converts 5hmdC and 5fdC into variants of uridine that are incorporated into DNA, resulting in accumulation of DNA damage, and ultimately, cell death
26181065 stimulation of PARP-1 activity in CDA-deficient cells restores replication and, thus, chromosome segregation. Moreover, increasing intracellular dCTP levels generates under-replication-induced sister-chromatid bridges as efficiently as PARP-1 knockdown
26090398 n the multivariate Cox regression analysis, we found that age at diagnosis, wild-type genotype of the CDA A79C polymorphism, and wild-type genotype of the dCK C360G polymorphism were the most significant prognostic factors for predicting the risk of death
26083014 RNA expression of deoxycytidine kinase (DCK), human equilibrative nucleoside transporter-1 (ENT1) and ribonucleotide reductase M1 (RRM1) were significantly higher and cytidine deaminase (CDA) was significantly lower in ex vivo Ara-C sensitive samples.
25850965 This case report calls for further prospective studies investigating the exact role that CDA status plays in the clinical outcome of patients treated with azacytidine.
25691056 Polymorphisms in ABCB1, CDA, ENOSF1,and TYMS could help to predict specific and overall severe adverse reactions to capecitabine.
25643696 miR-484-modulated cytidine deaminase has a dual impact in promoting chemoresistance and suppressing cell proliferation in breast cancer
25582275 These results suggest that CDA 79A>C polymorphisms is a potential biomarker for toxicity of gemcitabine-based chemotherapy and a CDA testing before gemcitabine administration is preferred.
More...

AA Sequence

MAQKRPACTLKPECVQQLLVCSQEAKKSAYCPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTA      1 - 70
IQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPE     71 - 140
DLQKTQ                                                                    141 - 146
//

Text Mined References (83)

PMID Year Title
26418006 2015 Cytidine Deaminase as a Molecular Predictor of Gemcitabine Response in Patients with Biliary Tract Cancer.
26354033 2015 Cytidine deaminase polymorphisms and worse treatment response in normal karyotype AML.
26200337 2015 CDA directs metabolism of epigenetic nucleosides revealing a therapeutic window in cancer.
26181065 2015 Pyrimidine Pool Disequilibrium Induced by a Cytidine Deaminase Deficiency Inhibits PARP-1 Activity, Leading to the Under Replication of DNA.
26090398 2015 Role of Genetic Polymorphisms of Deoxycytidine Kinase and Cytidine Deaminase to Predict Risk of Death in Children with Acute Myeloid Leukemia.
26083014 2015 RNA expression of genes involved in cytarabine metabolism and transport predicts cytarabine response in acute myeloid leukemia.
25850965 2015 Lethal toxicity after administration of azacytidine: implication of the cytidine deaminase-deficiency syndrome.
25691056 2015 Variants in CDA and ABCB1 are predictors of capecitabine-related adverse reactions in colorectal cancer.
25643696 2015 Cytidine Deaminase Axis Modulated by miR-484 Differentially Regulates Cell Proliferation and Chemoresistance in Breast Cancer.
25582275 2015 Cytidine deaminase polymorphism predicts toxicity of gemcitabine-based chemotherapy.
More...