Property Summary

NCBI Gene PubMed Count 88
PubMed Score 290.10
PubTator Score 165.36

Knowledge Summary

Patent (29,385)

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis 1.400 1.2e-02
osteosarcoma -1.513 1.1e-06
psoriasis 1.600 1.4e-05
tuberculosis -1.300 6.6e-04

Protein-protein Interaction (1)

Gene RIF (73)

AA Sequence

MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFLLGVIGNV      1 - 70
LVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLL     71 - 140
ACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQA    141 - 210
ETHAWFTSRFLYHVAGFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIF    211 - 280
LDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQ    281 - 350
LFPSWRRSSLSESENATSLTTF                                                    351 - 372
//

Text Mined References (89)

PMID Year Title