Property Summary

NCBI Gene PubMed Count 81
Grant Count 114
R01 Count 77
Funding $8,258,373.33
PubMed Score 264.13
PubTator Score 165.36

Knowledge Summary

Patent (29,385)

Synonym

Accession P32302 Q14811 CXC-R5
Symbols BLR1
CD185
MDR15

Gene

  TechDev Info (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
540340 confirmatory 0 / 0 / 19 SAR analysis counterscreen of small molecule antagonists of the CCR6 receptor using a CXCR5 receptor luminescent beta-arrestin assay
651594 confirmatory 2 / 0 / 0 Dose Response counterscreen of small molecule antagonists of the CXCR6 receptor using a CXCR5 receptor luminescent beta-arrestin assay
651601 confirmatory 1 / 0 / 5 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay
651919 confirmatory 6 / 0 / 30 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay - 4

Gene RIF (65)

PMID Text
26818544 HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21.
26752644 findings reveal a neuronal/astrocytic interaction in the spinal cord by which neuronally produced CXCL13 activates astrocytes via CXCR5 to facilitate neuropathic pain.
26640404 down-regulation of CXCR5 inhibited the growth and proliferation of LNCaP cells.
26517519 In patients with HBV-related hepatocellular carcinoma the phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered.
26462153 Authors demonstrate that CD40 expression upregulates the chemokine receptor CXCR5 and promotes MDSC migration toward and accumulation within cancer.
26333070 study showed that induction of circulating CXCR5+CD4+ Tfh-like subsets can be detected following immunization with HPV vaccines, and potentially be useful as a marker of immunogenicity of vaccines
25786345 elevated CXCR5 expression may contribute to abnormal cell survival and migration in breast tumors that lack functional p53.
25714983 IL-33 enhances humoral immunity against chronic hbv infection through activating CD4(+)CXCR5(+) helper-Inducer T-Lymphocytes.
25666935 A negative correlation between levels of miR-346 and percentages of CD4(+)CXCR5(+) T cells was confirmed in Graves' disease
25654980 Circulating CXCR5+CD4+helper T cells in systemic lupus erythematosus patients share phenotypic properties with germinal center follicular helper T cells and promote antibody production.
More...

AA Sequence

MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVPVAYSLIFLLGVIGNV      1 - 70
LVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLL     71 - 140
ACIAVDRYLAIVHAVHAYRHRRLLSIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLPRCTFSQENQA    141 - 210
ETHAWFTSRFLYHVAGFLLPMLVMGWCYVGVVHRLRQAQRRPQRQKAVRVAILVTSIFFLCWSPYHIVIF    211 - 280
LDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQ    281 - 350
LFPSWRRSSLSESENATSLTTF                                                    351 - 372
//

Text Mined References (82)

PMID Year Title
26818544 2016 CD4+CXCR5+ T cells activate CD27+IgG+ B cells via IL-21 in patients with hepatitis C virus infection.
26752644 2016 CXCL13 drives spinal astrocyte activation and neuropathic pain via CXCR5.
26640404 2015 The Differential Expression and Function of the Inflammatory Chemokine Receptor CXCR5 in Benign Prostatic Hyperplasia and Prostate Cancer.
26517519 2015 Phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered in HBV-related hepatocellular carcinoma and elevated serum CXCL13 predicted better prognosis.
26462153 2015 CD40 controls CXCR5-induced recruitment of myeloid-derived suppressor cells to gastric cancer.
26333070 2015 Circulating CXCR5?CD4? T Follicular-Like Helper Cell and Memory B Cell Responses to Human Papillomavirus Vaccines.
25786345 2015 p53-dependent expression of CXCR5 chemokine receptor in MCF-7 breast cancer cells.
25714983 2015 IL-33 Enhances Humoral Immunity Against Chronic HBV Infection Through Activating CD4(+)CXCR5(+) TFH Cells.
25666935 2015 MiR-346 regulates CD4?CXCR5? T cells in the pathogenesis of Graves' disease.
25654980 2015 Circulating CXCR5+CD4+helper T cells in systemic lupus erythematosus patients share phenotypic properties with germinal center follicular helper T cells and promote antibody production.
More...