Property Summary

NCBI Gene PubMed Count 195
Grant Count 64
R01 Count 26
Funding $9,220,987.23
PubMed Score 87.19
PubTator Score 110.74

Knowledge Summary

Patent (2,328)

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -1.700 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell 1.100 0.010
lung cancer 4.600 0.000
colon cancer -2.700 0.035
pediatric high grade glioma -1.100 0.004
group 3 medulloblastoma -1.500 0.034
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.105 0.014
lung carcinoma 1.700 0.000
psoriasis 1.300 0.000

Synonym

Accession P32297 Q15823 Q4KMN8 Q86U77 Q96RH3 Q99553 Q9BQ93 Q9BRR4
Symbols LNCR2
PAOD2
NACHRA3

Gene

PDB

4ZK4  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (170)

PMID Text
26942719 two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors
26689306 Our data suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers.
26527870 CHRNA3 - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
26010901 Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers.
26002565 Of the 2305 SNPs identified in the CHRNA3 gene, 115 were found to be non-synonymous and 12 and 15 nsSNPs were found to be in the 5' and 3' UTRs, respectively. 115 nsSNPs investigated, eight were predicted to be deleterious by both SIFT and PredictSNP servers.
25874685 The positive interaction between heavy smoking and the homozygous mutant CHRNA3 rs6495308 genotype was found to affect the likelihood of hypertension in Chinese male smokers.
25656608 the haplotype analysis found that the haplotypes "TCAC" and "CTGT," composed of rs938682, rs12914385, rs11637630, and rs2869546, were associated with a 1.79-fold and 501-fold increased lung cancer risk
25474695 CHRNA5-A3-B4 genotype associates with body mass index in never smokers.
25399010 The frequencies of genotype and allele in CHRNA3 (rs8040868) and PHACTR2 (rs9390123) were not significantly different between the NSCLC cases and controls, or between either of the subgroups.
25384568 Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities
More...

AA Sequence

MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQ      1 - 70
LVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL     71 - 140
LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAII    141 - 210
KAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVL    211 - 280
LSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLL    281 - 350
PRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT    351 - 420
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILG    421 - 490
TAGLFLQPLMAREDA                                                           491 - 505
//

Text Mined References (198)

PMID Year Title
26942719 2016 Chromosome 15q25 (CHRNA3-CHRNB4) Variation Indirectly Impacts Lung Cancer Risk in Chinese Males.
26689306 2016 Gene variance in the nicotinic receptor cluster (CHRNA5-CHRNA3-CHRNB4) predicts death from cardiopulmonary disease and cancer in smokers.
26527870 2015 Candidate genes for COPD: current evidence and research.
26010901 2015 Lack of Associations of CHRNA5-A3-B4 Genetic Variants with Smoking Cessation Treatment Outcomes in Caucasian Smokers despite Associations with Baseline Smoking.
26002565 2015 Identification of Deleterious SNPs and Their Effects on Structural Level in CHRNA3 Gene.
25874685 2015 CHRNA3 rs6495308 genotype as an effect modifier of the association between daily cigarette consumption and hypertension in Chinese male smokers.
25656608 2015 CHRNA3 genetic polymorphism and the risk of lung cancer in the Chinese Han smoking population.
25474695 2014 Stratification by smoking status reveals an association of CHRNA5-A3-B4 genotype with body mass index in never smokers.
25399010 2014 Association between polymorphisms in CHRNA3 and PHACTR2 gene and environment and NSCLC risk in Chinese population.
25384568 2014 Hippocampal changes produced by overexpression of the human CHRNA5/A3/B4 gene cluster may underlie cognitive deficits rescued by nicotine in transgenic mice.
More...