Property Summary

Ligand Count 23
NCBI Gene PubMed Count 206
PubMed Score 92.14
PubTator Score 110.74

Knowledge Summary

Patent (2,328)

Expression

  Differential Expression (11)

Disease log2 FC p
lung cancer 4.600 4.4e-06
Astrocytoma, Pilocytic -1.600 8.5e-05
colon cancer -2.700 3.5e-02
ependymoma -1.600 7.8e-07
glioblastoma -1.400 2.0e-04
group 3 medulloblastoma -1.500 3.4e-02
lung carcinoma 1.700 5.0e-15
medulloblastoma, large-cell 1.100 9.7e-03
pediatric high grade glioma -1.100 3.9e-03
psoriasis 1.300 1.1e-24
subependymal giant cell astrocytoma -1.105 1.4e-02

 CSPA Cell Line (1)

Gene RIF (180)

AA Sequence

MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQ      1 - 70
LVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL     71 - 140
LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAII    141 - 210
KAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVL    211 - 280
LSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLL    281 - 350
PRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT    351 - 420
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILG    421 - 490
TAGLFLQPLMAREDA                                                           491 - 505
//

Text Mined References (210)

PMID Year Title