Property Summary

NCBI Gene PubMed Count 17
Grant Count 9
R01 Count 4
Funding $1,764,774.34
PubMed Score 39.08
PubTator Score 22.96

Knowledge Summary

Patent (5,011)

Expression

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
651636 screening 2955 / 0 / 361213 uHTS identification of small molecule antagonists of the EBI2 receptor via a luminescent beta-arrestin assay
651641 summary 0 / 0 / 0 Summary assay for small molecule antagonists of the EBI2 receptor
651997 screening 696 / 0 / 1744 Single concentration confirmation of uHTS hits from a small molecule antagonists of the EBI2 receptor via a luminescent beta-arrestin assay
652000 screening 0 / 0 / 2440 Single concentration EBI2 agonist assay to profile uHTS hits from a small molecule antagonists of the EBI2 receptor
743408 confirmatory 68 / 0 / 5 SAR confirmation of small molecule antagonists of the EBI2 receptor via a luminescent beta-arrestin assa
743410 confirmatory 1 / 0 / 0 Dose-response characterization of small molecule antagonists of the EBI2 receptor via a chemotaxis assay
743411 confirmatory 2 / 0 / 0 Dose-response confirmation of small molecule antagonists of the EBI2 receptor via a luminescent beta-arrestin assay

Gene RIF (10)

PMID Text
25297897 These results demonstrate a role for EBI2 in astrocyte function and suggest that modulation of this receptor may be beneficial in neuroinflammatory disorders.
24480442 EBI2 is expressed in primary human monocytes and macrophages.
23473835 Chronic rhinosinusitis with nasal polyps is characterized by B-cell inflammation and EBV-induced protein 2 expression.
23333304 HIV-1 Vif upregulates the expression of G protein-coupled receptor 183 (GPR183) in Vif-expression T cells
22930711 This model of ligand docking yields important structural insight into the molecular mechanisms mediating EBI2 function.
22913878 Data indicate that EBI2 expression modulates CXCL13 binding affinity to CXCR5.
22875855 Molecular characterization of oxysterol binding to the Epstein-Barr virus-induced gene 2 (GPR183).
21261596 REVIEW: functional properties and in vivo biology
18628402 Structural motifs of importance for the constitutive activity of EBI2: analysis of receptor activation in the absence of an agonist.
16540462 Based on the constitutive signaling and cellular expression pattern of EBI2, it is suggested that it may function in conjunction with BILF1 in the reprogramming of the cell during EBV infection

AA Sequence

MDIQMANNFTPPSATPQGNDCDLYAHHSTARIVMPLHYSLVFIIGLVGNLLALVVIVQNRKKINSTTLYS      1 - 70
TNLVISDILFTTALPTRIAYYAMGFDWRIGDALCRITALVFYINTYAGVNFMTCLSIDRFIAVVHPLRYN     71 - 140
KIKRIEHAKGVCIFVWILVFAQTLPLLINPMSKQEAERITCMEYPNFEETKSLPWILLGACFIGYVLPLI    141 - 210
IILICYSQICCKLFRTAKQNPLTEKSGVNKKALNTIILIIVVFVLCFTPYHVAIIQHMIKKLRFSNFLEC    211 - 280
SQRHSFQISLHFTVCLMNFNCCMDPFIYFFACKGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQ    281 - 350
MMIHSKSSNGK                                                               351 - 361
//

Text Mined References (21)

PMID Year Title
25297897 2015 EBI2 regulates intracellular signaling and migration in human astrocyte.
24678947 2014 Identification and characterization of small molecule modulators of the Epstein-Barr virus-induced gene 2 (EBI2) receptor.
24480442 2014 Transcriptional regulation and functional characterization of the oxysterol/EBI2 system in primary human macrophages.
23772388 2013 Small molecule antagonism of oxysterol-induced Epstein-Barr virus induced gene 2 (EBI2) activation.
23473835 2013 Chronic rhinosinusitis with nasal polyps is characterized by B-cell inflammation and EBV-induced protein 2 expression.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22930711 2012 Identification of structural motifs critical for epstein-barr virus-induced molecule 2 function and homology modeling of the ligand docking site.
22913878 2012 EBI2 regulates CXCL13-mediated responses by heterodimerization with CXCR5.
22875855 2012 Molecular characterization of oxysterol binding to the Epstein-Barr virus-induced gene 2 (GPR183).
21796212 2011 Oxysterols direct immune cell migration via EBI2.
More...