Property Summary

Ligand Count 2
NCBI Gene PubMed Count 22
PubMed Score 45.72
PubTator Score 22.96

Knowledge Summary

Patent (5,011)

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.104 2.8e-02
adult high grade glioma 1.400 6.3e-03
Astrocytoma, Pilocytic 1.800 6.4e-06
cutaneous lupus erythematosus 2.400 8.2e-04
glioblastoma 1.700 4.1e-02
interstitial cystitis 1.900 4.4e-03
intraductal papillary-mucinous adenoma (... -1.100 3.4e-02
intraductal papillary-mucinous carcinoma... -1.600 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-02
invasive ductal carcinoma 1.732 1.5e-02
lung cancer -1.800 1.7e-03
lung carcinoma -1.800 3.3e-12
oligodendroglioma -1.200 3.0e-02
ovarian cancer 1.300 2.4e-03
primary Sjogren syndrome 2.100 5.8e-04
psoriasis -1.500 3.6e-07
tuberculosis -2.000 3.3e-04
ulcerative colitis 3.100 1.0e-06
Waldenstrons macroglobulinemia 1.914 4.8e-03

Gene RIF (15)

AA Sequence

MDIQMANNFTPPSATPQGNDCDLYAHHSTARIVMPLHYSLVFIIGLVGNLLALVVIVQNRKKINSTTLYS      1 - 70
TNLVISDILFTTALPTRIAYYAMGFDWRIGDALCRITALVFYINTYAGVNFMTCLSIDRFIAVVHPLRYN     71 - 140
KIKRIEHAKGVCIFVWILVFAQTLPLLINPMSKQEAERITCMEYPNFEETKSLPWILLGACFIGYVLPLI    141 - 210
IILICYSQICCKLFRTAKQNPLTEKSGVNKKALNTIILIIVVFVLCFTPYHVAIIQHMIKKLRFSNFLEC    211 - 280
SQRHSFQISLHFTVCLMNFNCCMDPFIYFFACKGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQ    281 - 350
MMIHSKSSNGK                                                               351 - 361
//

Text Mined References (26)

PMID Year Title