Property Summary

NCBI Gene PubMed Count 223
Grant Count 323
R01 Count 190
Funding $37,454,362.41
PubMed Score 928.03
PubTator Score 541.86

Knowledge Summary

Patent (56,084)

Expression

  Differential Expression (14)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.355 0.018
cutaneous lupus erythematosus 3.200 0.001
psoriasis 2.700 0.000
osteosarcoma -2.673 0.000
Atopic dermatitis 1.800 0.002
tuberculosis -1.900 0.000
Common variable immunodeficiency -1.603 0.014
lung cancer -1.700 0.002
interstitial cystitis 2.900 0.006
primary Sjogren syndrome 1.300 0.004
sarcoidosis -1.400 0.000
ductal carcinoma in situ 2.100 0.010
invasive ductal carcinoma 1.900 0.015
ulcerative colitis 2.300 0.001

Synonym

Accession P32248 C-C CKR-7
Symbols BLR2
EBI1
CCR-7
CD197
CDw197
CMKBR7
CC-CKR-7

Gene

  TechDev Info (1)

Gene RIF (198)

PMID Text
26884842 CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer.
26722441 The present study demonstrated that down-regulation of CCR7 reduced proliferation, cell cycle, cell migration and invasion in prostate cancer cells
26667143 Our findings suggested that MUC1 plays an important role in CCL21-CCR7-induced lymphatic metastasis and may serve as a therapeutic target in esophageal squamous cell carcinoma .
26352871 Membrane associated PGES1dependent release of PGE2 is ccompanied by elevated CCR7 expression in colon cancer cells.
26352169 Pyk2 is a key downstream signaling molecules of CCR7 in SCCHN, which promotes SCCHN tumorigenesis and progression.
26282174 Recycling accounts, to a major extent, for the high levels of surface CXCR4/CCR7 on CLL cells. Increased CCR4/CCR7 is detectable not only in circulating leukemic cells, but also in secondary lymphoid organs of CLL patients with lymphoadenopathy.
26231034 findings indicated that circulating memory Tfh cells, especially CCR7+ICOS+ memory Tfh cells, may be associated with the relapse of MS and may serve as a new therapeutic target
26215564 HIV-1 (NL4-3) Vpu downregulates CCR7 expression on cells (primary CD4+ T cells)
26215564 HIV-1 (NL4-3) Vpu downregulates CCR7 expression on cells (primary CD4+ T cells)
26179425 High CCR7 expression was associated with colorectal cancer metastasis.
More...

AA Sequence

MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICF      1 - 70
VGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSF     71 - 140
FSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRC    141 - 210
SLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYN    211 - 280
GVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQE    281 - 350
QLRQWSSCRHIRRSSMSVEAETTTTFSP                                              351 - 378
//

Text Mined References (223)

PMID Year Title
26884842 2015 CCL21/CCR7 up-regulate vascular endothelial growth factor-D expression via ERK pathway in human non-small cell lung cancer cells.
26722441 2015 Silencing of CCR7 inhibits the growth, invasion and migration of prostate cancer cells induced by VEGFC.
26667143 2015 CCL21-CCR7 promotes the lymph node metastasis of esophageal squamous cell carcinoma by up-regulating MUC1.
26352871 2015 Upregulation of C-C chemokine receptor type 7 expression by membrane-associated prostaglandin E synthase-1/prostaglandin E2 requires glycogen synthase kinase 3?-mediated signal transduction in colon cancer cells.
26352169 2015 The role of Pyk2 in the CCR7-mediated regulation of metastasis and viability in squamous cell carcinoma of the head and neck cells in vivo and in vitro.
26282174 2015 Enhanced Chemokine Receptor Recycling and Impaired S1P1 Expression Promote Leukemic Cell Infiltration of Lymph Nodes in Chronic Lymphocytic Leukemia.
26231034 2015 Circulating CCR7+ICOS+ Memory T Follicular Helper Cells in Patients with Multiple Sclerosis.
26179425 2015 The prognostic significance and relationship with body composition of CCR7-positive cells in colorectal cancer.
26176983 2015 CCR7 enhances TGF-?1-induced epithelial-mesenchymal transition and is associated with lymph node metastasis and poor overall survival in gastric cancer.
26115234 2015 Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites.
More...