Property Summary

NCBI Gene PubMed Count 242
PubMed Score 983.06
PubTator Score 541.86

Knowledge Summary

Patent (56,084)

Expression

  Differential Expression (14)

Disease log2 FC p
tuberculosis -1.900 1.5e-04
Atopic dermatitis 1.800 2.4e-03
Chronic Lymphocytic Leukemia 1.355 1.8e-02
Common variable immunodeficiency -1.603 1.4e-02
cutaneous lupus erythematosus 3.200 1.0e-03
ductal carcinoma in situ 2.100 1.0e-02
interstitial cystitis 2.900 5.9e-03
invasive ductal carcinoma 1.900 1.5e-02
lung cancer -1.700 2.5e-03
osteosarcoma -2.673 6.2e-05
primary Sjogren syndrome 1.300 3.8e-03
psoriasis 1.200 1.8e-02
sarcoidosis -1.400 6.7e-05
ulcerative colitis 2.300 8.8e-04

Gene RIF (213)

AA Sequence

MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICF      1 - 70
VGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSF     71 - 140
FSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRC    141 - 210
SLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYN    211 - 280
GVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQE    281 - 350
QLRQWSSCRHIRRSSMSVEAETTTTFSP                                              351 - 378
//

Text Mined References (242)

PMID Year Title