Property Summary

Ligand Count 108
NCBI Gene PubMed Count 19
PubMed Score 167.71
PubTator Score 84.12

Knowledge Summary

Patent (14,212)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 2.6e-09
medulloblastoma, large-cell 6241 7.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Obesity 678 4.057 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 7.4e-05
ovarian cancer -1.700 2.6e-09

Gene RIF (13)

AA Sequence

MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIK      1 - 70
VFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTI     71 - 140
LSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSK    141 - 210
KLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALF    211 - 280
ALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKA    281 - 350
ERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF                         351 - 399
//

Text Mined References (20)

PMID Year Title