Property Summary

NCBI Gene PubMed Count 19
Grant Count 73
R01 Count 24
Funding $17,485,819.08
PubMed Score 161.15
PubTator Score 84.12

Knowledge Summary

Patent (14,212)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 0.000
ovarian cancer -1.700 0.000

Synonym

Accession P32247 BRS-3
Symbols BB3
BB3R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (13)

PMID Text
26020940 mammalian homologue of CCHa2-R, Bombesin receptor subtype-3 (Brs3), is an orphan receptor that is expressed in the islet beta-cells
25241033 High BRS3 expression is associated with liver metastases of pancreas neuroendocrine tumors.
24326363 Data show that gastrin-releasing peptide receptor/bombesin receptor subtype-3 positive cells and protein expression in tumors decreased by treatment with RC-3095 or gemcitabine alone or greater in combination.
24220502 The role of the human BRS-3 receptor in glucose homeostasis.
23291341 BRS-3 plays an important role in glucose metabolism.
22127929 BRS-3 agonist-dependent signaling mediates CREB phosphorylation and transactivation through protein kinase (PK)A, (PK)C, and mitogen-activated protein/extracellular regulated kinase kinase (MEK)-1 pathways.
21878513 These results identify a potential role for BRS-3 in islet physiology, with agonism directly promoting glucose-stimulated insulin secretion
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17714959 The secretion of TGF-beta1 increased and the synthesis of PGE2 decreased from BRS-3-activated BEC, which were correlated with the proliferation and collagen synthesis of HLF.
More...

AA Sequence

MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIK      1 - 70
VFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTI     71 - 140
LSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSK    141 - 210
KLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALF    211 - 280
ALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKA    281 - 350
ERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF                         351 - 399
//

Text Mined References (20)

PMID Year Title
26020940 2015 The Nutrient-Responsive Hormone CCHamide-2 Controls Growth by Regulating Insulin-like Peptides in the Brain of Drosophila melanogaster.
25241033 2014 Gene expression accurately distinguishes liver metastases of small bowel and pancreas neuroendocrine tumors.
24326363 2014 RC-3095, a gastrin-releasing peptide receptor antagonist, synergizes with gemcitabine to inhibit the growth of human pancreatic cancer CFPAC-1 in vitro and in vivo.
24220502 2014 Human BRS-3 receptor: functions/role in cell signaling pathways and glucose metabolism in obese or diabetic myocytes.
23291341 2013 Bombesin receptor subtype-3 (BRS-3), a novel candidate as therapeutic molecular target in obesity and diabetes.
22127929 2012 A selective human bombesin receptor subtype-3 peptide agonist mediates CREB phosphorylation and transactivation.
21878513 2011 Bombesin receptor subtype-3 (BRS-3) regulates glucose-stimulated insulin secretion in pancreatic islets across multiple species.
21857995 2011 Cloning of a novel protein interacting with BRS-3 and its effects in wound repair of bronchial epithelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...