Property Summary

NCBI Gene PubMed Count 121
Grant Count 148
R01 Count 89
Funding $10,606,117.56
PubMed Score 312.22
PubTator Score 269.11

Knowledge Summary

Patent (46,869)

Expression

Synonym

Accession P32246 Q86VA9 C-C CKR-1
Symbols CKR1
CD191
CKR-1
HM145
CMKBR1
MIP1aR
SCYAR1

Gene

PDB

1Y5D  

Gene RIF (82)

PMID Text
26472202 The residues on the N-loop and beta-sheets of MIP-1a are close to both CCR1 and CCR5, and those in the C-terminal helix region are close to CCR5.
26341919 CCL15-positive primary colorectal cancers recruited approximately 2.2 times more numbers of CCR1(+) cells.
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
25986216 Results highlight the potential role of CCR genes in narcolepsy and support the hypothesis that patients with narcolepsy have impaired immune function.
25487697 This study reveled that CCR1 having a central role in the bipolar disease and schizophrenia manifestation.
24990525 Identifying bias in CCR1 antagonists using radiolabelled binding, receptor internalization, beta-arrestin translocation and chemotaxis assays
24778447 cross-desensitization of CCR1 by FPR1 was associated with CCR1 phosphorylation and moderate reduction of CCR1 cell-surface expression. In contrast, CCR2 was not phosphorylated or internalized after FPR1 activation.
24599574 These results suggest that increased CC-chemokine receptor expression may play a role in the pathogenesis of adenomyosis.
24489825 HIV-1 Nef induces variable levels of CCR1 downregulation in different cell types
24157267 Our results confirm the strong influence of previous immunity in subsequent dengue infections, and confer a possible pathogenic role to CCR1 and CCL3 in dengue disease and a possible protective role for CCL5, probably through CCR5 interaction.
More...

AA Sequence

METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTS      1 - 70
IYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVF     71 - 140
ALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVL    141 - 210
PLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLD    211 - 280
LAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHE    281 - 350
LSAGF                                                                     351 - 355
//

Text Mined References (121)

PMID Year Title
26472202 2015 Elucidation of the CCR1- and CCR5-binding modes of MIP-1? by application of an NMR spectra reconstruction method to the transferred cross-saturation experiments.
26341919 2016 Loss of SMAD4 Promotes Colorectal Cancer Progression by Accumulation of Myeloid-Derived Suppressor Cells through the CCL15-CCR1 Chemokine Axis.
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
25986216 2015 A polymorphism in CCR1/CCR3 is associated with narcolepsy.
25487697 2015 Innate immune response is differentially dysregulated between bipolar disease and schizophrenia.
24990525 2014 Identifying bias in CCR1 antagonists using radiolabelled binding, receptor internalization, ?-arrestin translocation and chemotaxis assays.
24778447 2014 Cross-desensitization of CCR1, but not CCR2, following activation of the formyl peptide receptor FPR1.
24599574 2014 Increased endometrial expression of CC-chemokine receptor-1 in women with adenomyosis.
24157267 2014 Role of CC chemokine receptor 1 and two of its ligands in human dengue infection. Three approaches under the Cuban situation.
24056371 2013 The chemokine receptor CCR1 is constitutively active, which leads to G protein-independent, ?-arrestin-mediated internalization.
More...