Property Summary

NCBI Gene PubMed Count 341
Grant Count 487
R01 Count 301
Funding $42,128,170.11
PubMed Score 884.64
PubTator Score 744.09

Knowledge Summary

Patent (70,078)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.028
ependymoma -1.600 0.027
oligodendroglioma -1.600 0.013
diabetes mellitus 1.100 0.002
pituitary cancer 1.500 0.024

Synonym

Accession P32245 B2RAC3 Q16317 Q3MIJ6 MC4-R
Symbols

Gene

PANTHER Protein Class (2)

PDB

2IQP   2IQR   2IQS   2IQU   2IQV   2IQW  

  TechDev Info (1)

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
540295 screening 1704 / 0 / 354703 TRFRET-based cell-based primary high throughput screening assay to identify biased ligands of the melanocortin 4 receptor (MC4R): antagonists of MC4R
540307 summary 0 / 0 / 0 Summary of the probe development efforts to identify biased ligands of the melanocortin 4 receptor (MC4R): antagonists of MC4R
540308 screening 3476 / 0 / 352931 Luminescence-based cell-based primary high throughput screening assay to identify biased ligands of the melanocortin 4 receptor (MC4R): agonists of MC4R
540319 summary 0 / 0 / 0 Summary of the probe development efforts to identify biased ligands of the melanocortin 4 receptor (MC4R): agonists of MC4R
602192 screening 750 / 0 / 1649 Luminescence-based cell-based high throughput confirmation assay for biased ligands (agonists) of the melanocortin 4 receptor (MC4R)
602195 screening 430 / 0 / 1152 TRFRET-based cell-based high throughput confirmation assay for biased ligands (antagonists) of the melanocortin 4 receptor (MC4R)
602263 confirmatory 14 / 0 / 217 Luminescence-based cell-based high throughput dose response assay for biased ligands (agonists) of the melanocortin 4 receptor (MC4R)
602298 confirmatory 33 / 0 / 189 TRFRET-based cell-based high throughput dose response assay for biased ligands (antagonists) of the melanocortin 4 receptor (MC4R)
651547 confirmatory 0 / 0 / 15 Late-stage FRET-based cell-based primary screening assay to identify biased ligands of the melanocortin 4 receptor (MC4R): agonists of MC4R
651554 other 3 / 0 / 24 Late-stage FRET-based cell-based primary screening assay to identify biased ligands of the melanocortin 4 receptor (MC4R): antagonists of MC4R
More...

Gene RIF (355)

PMID Text
26965781 MC4R (melanocortin-4 receptor) rs17782313 gene polymorphism is associated with higher triglyceride levels in older Chinese women
26849546 Obese children carrying the FTO GG and/or the MC4R CC genotype lost more body weight in comparison to non-carriers from a lifestyle intervention.
26814590 Drawing on recent advances in neuroscience and genetic technologies, we consider the structure and function of the melanocortin-4 receptor circuitry and its role in energy homeostasis--{REVIEW}
26782456 this molecular analysis of a family-based study showed an autosomal dominant pattern. Our study indicated that MC4R variations in early-onset obese Thai children were found, and transmission of these variations in each family is in the dominant pattern
26680479 The MC4R variant (rs12970134) was associated with increased risk for obesity in Czech women.
26588347 Uncontrolled eating scores were higher in C-allele carriers of MC4R-rs17782313 compared to non-carriers.
26469516 Data show that co-expression with MRAPalpha, but not MRAP2, enhances MC4R constitutive activity. MRAPalpha-enhanced MC4R constitutive activity is not dependent on MC4R complex glycosylation but may result from MRAPalpha-induced changes in MC4R conformational states.
26244670 MC4R mutations contribute to the onset of obesity.
26238496 The age of obesity onset in the present child generation of MC4R mutation carriers is decreasing compared to the age of onset in their parents' generation.
26032905 The interaction between FTO and MC4R polymorphisms is associated with the development of PCOS.
More...

AA Sequence

MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIA      1 - 70
KNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSL     71 - 140
LSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMAS    141 - 210
LYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCF    211 - 280
MSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSSRY                      281 - 332
//

Text Mined References (342)

PMID Year Title
26965781 2016 Melanocortin-4 receptor rs17782313 polymorphisms are associated with serum triglycerides in older Chinese women.
26849546 2015 The Impact of Physical Activity and Dietary Measures on the Biochemical and Anthropometric Parameters in Obese Children. Is There Any Genetic Predisposition?
26814590 2016 Melanocortin-4 receptor-regulated energy homeostasis.
26782456 2015 Genetic variant screening of MC3R and MC4R genes in early-onset obese children and their relatives among a Thai population: family-based study.
26680479 2015 Metabolic and hormonal consequencies of the "obesity risk" MC4R variant (rs12970134) in Czech women.
26588347 2016 Melanocortin-4 Receptor Gene Variation Is Associated with Eating Behavior in Chilean Adults.
26469516 2015 hMRAP?, but Not hMRAP2, Enhances hMC4R Constitutive Activity in HEK293 Cells and This Is Not Dependent on hMRAP? Induced Changes in hMC4R Complex N-linked Glycosylation.
26244670 2016 The prevalence of melanocortin-4 receptor gene mutations in Slovak obese children and adolescents.
26238496 2015 Age of obesity onset in MC4R mutation carriers.
26032905 2015 Interaction between common variants of FTO and MC4R is associated with risk of PCOS.
More...