Property Summary

NCBI Gene PubMed Count 84
Grant Count 176
R01 Count 85
Funding $31,667,150.83
PubMed Score 403.67
PubTator Score 316.13

Knowledge Summary

Patent (38,157)

Expression

  Differential Expression (23)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 0.034
astrocytoma -1.300 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.100 0.000
osteosarcoma -1.245 0.005
chronic lymphosyte leukemia 1.100 0.003
posterior fossa group A ependymoma -1.800 0.000
group 3 medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.800 0.001
non-small cell lung cancer -2.439 0.000
colon cancer -1.900 0.024
lung cancer -2.500 0.000
active Crohn's disease -1.621 0.024
interstitial cystitis -2.000 0.000
lung adenocarcinoma -2.500 0.000
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.500 0.000
subependymal giant cell astrocytoma -1.533 0.015
inflammatory breast cancer -1.300 0.000
lung carcinoma -1.600 0.000
ulcerative colitis -2.100 0.000

Synonym

Accession P32241 A5JUT9 B3KPV1 B4DEB5 B4DGI4 F5H1F5 G3V0I1 Q15871 Q6P2M6 VIP-R-1
Symbols II
HVR1
RDC1
V1RG
VIPR
VIRG
VAPC1
VPAC1
VPAC1R
VIP-R-1
VPCAP1R
PACAP-R2
PACAP-R-2

Gene

PDB

1OF2   1OGT   3B3I   3B6S   3DTX   3HCV   5DEF   5DEG  

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (59)

PMID Text
26881970 The results reveal that more severe inflammation, based on high levels of IL-6, is associated with lower expression of VPAC1 and, conversely, with increased expression of VPAC2.
25390694 variations at the 3'UTR of the VPAC-1 gene act synergistically to affect the expression of the luciferase as well as of the GFP reporter genes expressed in HEK293T cells.
24788249 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKCepsilon-dependent manner.
24671823 These data suggest that VPAC1 overexpression is associated with poorer differentiation of colon cancer, which is likely caused by subsequent EGFR activation in cancer cells.
23898208 HIV-1 Tat downregulates the expression of vasoactive intestinal peptide receptor 1 (VIPR1) in human primary T cells
23651810 VPAC1 receptor has a role in endotoxemia in peripheral blood mononuclear cells
22763881 The overexpression of VPAC1 and VPAC2 receptors and COX-2 in cancer tissue gives them a potential role as targets for diagnosis of prostate cancer.
22291440 hree residues play an important role in VPAC1 interaction with the first histidine residue of VIP. These data demonstrate that VIP and PG97-269 bind to distinct domains of VPAC1
22166542 The genetic association reported here indicates that VIP/VPAC1 signaling can be a relevant pathway in the pathogenesis of type 2 diabetes in females
21896307 silencing of VPAC1 receptor inhibits vasoactive intestinal peptide effects on both EGF receptor and HER2 transactivation and vascular endothelial growth factor secretion in human breast cancer cells
More...

AA Sequence

MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNL      1 - 70
TCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYG     71 - 140
SVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGESDQCSE    141 - 210
GSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHF    211 - 280
EDYGCWDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLF    281 - 350
GVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH    351 - 420
PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV                                     421 - 457
//

Text Mined References (89)

PMID Year Title
26881970 2016 Clinical Relevance of VPAC1 Receptor Expression in Early Arthritis: Association with IL-6 and Disease Activity.
25390694 2014 Single nucleotide polymorphisms in the 3'UTR of VPAC-1 cooperate in modulating gene expression and impact differently on the interaction with miR525-5p.
24788249 2014 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKC?-dependent manner.
24671823 2014 VPAC1 overexpression is associated with poor differentiation in colon cancer.
23651810 2013 VPAC1 receptor expression in peripheral blood mononuclear cells in a human endotoxemia model.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22763881 2012 Overexpression of vasoactive intestinal peptide receptors and cyclooxygenase-2 in human prostate cancer. Analysis of potential prognostic relevance.
22291440 2012 Spatial proximity between the VPAC1 receptor and the amino terminus of agonist and antagonist peptides reveals distinct sites of interaction.
22166542 2012 Gender-dependent association of type 2 diabetes with the vasoactive intestinal peptide receptor 1.
More...