Property Summary

Ligand Count 2
NCBI Gene PubMed Count 86
PubMed Score 410.64
PubTator Score 316.13

Knowledge Summary

Patent (38,157)


  Differential Expression (23)

Disease log2 FC p
active Crohn's disease -1.621 2.4e-02
adult high grade glioma -1.200 5.3e-03
astrocytoma -1.100 1.9e-28
Astrocytoma, Pilocytic -1.600 7.3e-06
atypical teratoid / rhabdoid tumor -1.800 3.1e-08
chronic lymphosyte leukemia 1.100 2.9e-03
colon cancer -1.500 1.5e-02
cutaneous lupus erythematosus -1.600 3.4e-02
ependymoma -1.500 1.9e-06
glioblastoma -1.700 4.9e-09
group 3 medulloblastoma -2.300 2.3e-04
inflammatory breast cancer -1.300 1.7e-04
interstitial cystitis -1.500 2.8e-03
lung adenocarcinoma -1.900 3.0e-14
lung cancer -2.500 7.7e-05
lung carcinoma -1.600 3.7e-06
medulloblastoma, large-cell -1.900 1.6e-06
non-small cell lung cancer -2.439 8.6e-19
oligodendroglioma -1.100 2.3e-21
osteosarcoma -1.245 4.6e-03
primitive neuroectodermal tumor -1.800 1.4e-03
subependymal giant cell astrocytoma -1.533 1.5e-02
ulcerative colitis -2.100 2.4e-07

PDB (13)

Gene RIF (61)

AA Sequence

PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV                                     421 - 457

Text Mined References (91)

PMID Year Title