Property Summary

NCBI Gene PubMed Count 113
Grant Count 99
R01 Count 59
Funding $7,901,581.53
PubMed Score 514.65
PubTator Score 462.43

Knowledge Summary

Patent (15,589)

Expression

  Differential Expression (20)

Synonym

Accession P32239 A8K7P9 O75824 Q16144 Q92492 Q96LC6 Q9NYK7 Q9UBV1 CCK-B receptor
Symbols GASR
CCK-B
CCK2R

Gene

PANTHER Protein Class (2)

PDB

1L4T  

  TechDev Info (1)

Gene RIF (83)

PMID Text
26608796 The neurotransmitter cholecystokinin (CCK), along with its receptors, CCKAR and CCKBR, have been previously associated with psychiatric disorders, suggesting that variants near these genes may play a role in the pre-pulse/startle response in this cohort
26520651 This study showed that CCK2 receptors were highly expressed within the cytoplasmic area of cancerous cells, whereas the levels were very low in normal tissues.
25875176 There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.
25601282 treatment with gastrin, a CCK2R agonist, stimulated the secretion of GLP-1, and that this effect was likely due to increased expression of proglucagon and PCSK1 (also known as prohormone convertase 3 (PC3 gene)).
25469546 CCK-BR SNP predicts survival and should be studied as a candidate genetic biomarker for those at risk of pancreatic cancer.
24623766 DeltaFosB induction in prelimbic area occurred selectively in susceptible mice after chronic social defeat stress and produced these effects partly through induction of the cholecystokinin (CCK)-B receptor.
24211650 The gastrin receptor is a promising tumor cell surface target for future prostate-cancer-specific imaging applications.
23975374 CCKBR and Bcl-2 were identified as targets of miR-148a.
23890582 some CCKBR polymorphisms may contribute to an underlying predisposition towards suicidal behaviour in bipolar disorder.
23376640 Suggest that CCK2R-mediated COX-2 up-regulation via JAK2/STAT3/PI3K/Akt pathway is involved in the proliferative effect of gastrin on human gastric cancer cells.
More...

AA Sequence

MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVG      1 - 70
GNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSV     71 - 140
STLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWP    141 - 210
SARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCR    211 - 280
PETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVY    281 - 350
SANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL    351 - 420
PDEDPPTPSIASLSRLSYTTISTLGPG                                               421 - 447
//

Text Mined References (117)

PMID Year Title
26608796 2015 Variants Near CCK Receptors are Associated With Electrophysiological Responses to Pre-pulse Startle Stimuli in a Mexican American Cohort.
26520651 Immunohistochemical examination of cholecystokinin and gastrin receptors (CCK-2/gastrin-R) expression in normal and exocrine cancerous human pancreatic tissues.
25875176 2015 Functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.
25601282 2015 Expression of cholecystokinin2-receptor in rat and human L cells and the stimulation of glucagon-like peptide-1 secretion by gastrin treatment.
25469546 2015 Distribution of cholecystokinin-B receptor genotype between patients with pancreatic cancer and controls and its impact on survival.
25416956 2014 A proteome-scale map of the human interactome network.
24623766 2014 Prefrontal cortical circuit for depression- and anxiety-related behaviors mediated by cholecystokinin: role of ?FosB.
24211650 2014 The gastrin/cholecystokinin-B receptor on prostate cells--a novel target for bifunctional prostate cancer imaging.
24177032 2014 Cholecystokinin and pancreatic cancer: the chicken or the egg?
23975374 2014 MiR-148a regulates the growth and apoptosis in pancreatic cancer by targeting CCKBR and Bcl-2.
More...