Property Summary

Ligand Count 570
NCBI Gene PubMed Count 119
PubMed Score 529.52
PubTator Score 462.43

Knowledge Summary

Patent (15,589)

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.600 1.3e-03
astrocytic glioma -2.000 4.3e-03
Astrocytoma, Pilocytic -1.700 1.4e-06
atypical teratoid / rhabdoid tumor -1.900 7.1e-05
cutaneous lupus erythematosus -1.300 2.1e-03
Down syndrome -1.300 7.4e-04
ependymoma -2.300 9.5e-04
glioblastoma -1.900 2.3e-08
group 3 medulloblastoma -2.300 5.5e-04
intraductal papillary-mucinous carcinoma... -2.400 1.5e-02
intraductal papillary-mucinous neoplasm ... -2.200 4.5e-02
medulloblastoma, large-cell -2.300 3.6e-06
oligodendroglioma -1.900 5.4e-03
ovarian cancer 1.100 9.9e-10
pancreatic cancer -1.500 5.3e-04
Pick disease -1.200 1.1e-02
primary pancreatic ductal adenocarcinoma -2.189 1.9e-04
primitive neuroectodermal tumor -2.700 9.9e-08
psoriasis -2.700 1.2e-63
subependymal giant cell astrocytoma -1.806 4.2e-02

Protein-protein Interaction (8)

Gene RIF (89)

AA Sequence

MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVG      1 - 70
GNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSV     71 - 140
STLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWP    141 - 210
SARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCR    211 - 280
PETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVY    281 - 350
SANTWRAFDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL    351 - 420
PDEDPPTPSIASLSRLSYTTISTLGPG                                               421 - 447
//

Text Mined References (123)

PMID Year Title