Property Summary

NCBI Gene PubMed Count 81
Grant Count 131
R01 Count 102
Funding $15,567,343.97
PubMed Score 532.00
PubTator Score 256.25

Knowledge Summary

Patent (16,627)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 0.000

Synonym

Accession P32238 B2R9Z5 CCK-A receptor
Symbols CCK-A
CCK1R
CCKRA
CCK1-R

Gene

PANTHER Protein Class (2)

PDB

1D6G   1HZN   1PB2  

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (68)

PMID Text
26608796 The neurotransmitter cholecystokinin (CCK), along with its receptors, CCKAR and CCKBR, have been previously associated with psychiatric disorders, suggesting that variants near these genes may play a role in the pre-pulse/startle response in this cohort
26551933 CCK-AR polymorphism is protective against functional dyspepsia.
25875176 There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.
25025063 Age related differential expression of CCKAR in GBC may suggest two possible variants of the disease in this endemic belt.
24914377 CCK binding modulates the contractile function of the lower esophageal sphincter through differential binding to the CCK-A receptor on the sling and clasp fibers
24825903 Y140A mutation within a cholesterol-binding motif results in ligand binding and activity characteristics similar to wild type CCK1R. in a high cholesterol environment
23701593 The findings suggest that variants in the CCKAR gene may influence the risk of gallbladder cancer in women.
23341962 A significant association of the cholecystokinin-A receptor (CCKAR) gene variation rs1800857 and language lateralization, is reported.
22825913 The results showed that three individual haplotypes of CCKAR were strongly associated with increased risk of schizophrenia.
22396142 Data suggest that CCK-1R expression is up-regulated in kidney tubules (but not in glomeruli) in patients with diabetic nephropathy; increased expression of CCK-1R in tubules appears to be biomarker of severity of proteinuria in these patients.
More...

AA Sequence

MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK      1 - 70
RMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERY     71 - 140
GAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWH    141 - 210
TFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKL    211 - 280
ELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGT    281 - 350
PISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH    351 - 420
MSASVPPQ                                                                  421 - 428
//

Text Mined References (82)

PMID Year Title
26608796 2015 Variants Near CCK Receptors are Associated With Electrophysiological Responses to Pre-pulse Startle Stimuli in a Mexican American Cohort.
26551933 2016 Functional dyspepsia is associated with GN?3 C825T and CCK-AR T/C polymorphism.
25875176 2015 Functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.
25025063 2014 Differential expression of cholecystokinin A receptor in gallbladder cancer in the young and elderly suggests two subsets of the same disease?
24914377 2014 Investigation of cholecystokinin receptors in the human lower esophageal sphincter.
24825903 2014 A type 1 cholecystokinin receptor mutant that mimics the dysfunction observed for wild type receptor in a high cholesterol environment.
23701593 2013 Variants in CCK and CCKAR genes to susceptibility to biliary tract cancers and stones: a population-based study in Shanghai, China.
23341962 2013 Cholecystokinin A receptor (CCKAR) gene variation is associated with language lateralization.
22825913 2012 Investigation of allelic heterogeneity of the CCK-A receptor gene in paranoid schizophrenia.
22396142 2012 Expression of cholecystokinin-1 receptor is correlated with proteinuria in human diabetic nephropathy.
More...