Property Summary

Ligand Count 192
NCBI Gene PubMed Count 84
PubMed Score 539.13
PubTator Score 256.25

Knowledge Summary

Patent (16,627)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 3.3e-10

Protein-protein Interaction (1)

Gene RIF (71)

AA Sequence

MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK      1 - 70
RMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERY     71 - 140
GAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWH    141 - 210
TFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKL    211 - 280
ELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGT    281 - 350
PISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH    351 - 420
MSASVPPQ                                                                  421 - 428
//

Text Mined References (85)

PMID Year Title