Property Summary

NCBI Gene PubMed Count 248
PubMed Score 487.76
PubTator Score 340.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.100 2.5e-02
lung cancer -1.400 4.6e-04
lung carcinoma -1.600 1.6e-25
malignant mesothelioma 2.000 7.4e-07
non-small cell lung cancer -1.290 6.3e-19
osteosarcoma -2.165 8.1e-04

 GWAS Trait (1)

Gene RIF (197)

AA Sequence

MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLD      1 - 70
VLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKA     71 - 140
CGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYY    141 - 210
HGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLS    211 - 280
DNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPH    281 - 350
DHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC               351 - 409
//

Text Mined References (267)

PMID Year Title