Property Summary

NCBI Gene PubMed Count 225
Grant Count 152
R01 Count 88
Funding $9,787,768.73
PubMed Score 434.63
PubTator Score 340.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
osteosarcoma -2.165 0.001
glioblastoma 1.100 0.025
non-small cell lung cancer -1.290 0.000
lung cancer -1.400 0.000
lung carcinoma -1.600 0.000

Synonym

Accession P32121 B4DLW0 B5B0C0 B7WPL3 D3DTK2 H0Y688 Q0Z8D3 Q2PP19 Q6ICT3 Q8N7Y2 Q9UEQ6
Symbols ARB2
ARR2
BARR2

Gene

PANTHER Protein Class (1)

Gene RIF (180)

PMID Text
27007855 interaction of beta-arrestin with GPCRs, and the beta-arrestin conformational changes in real time and in living human cells, using a series of fluorescence resonance energy transfer (FRET)-based beta-arrestin2 biosensors
26957205 Data suggest that thrombin can directly activate PAR2 vasorelaxation, signal transduction (stimulating both calcium and MAP kinase responses), and triggering beta-arrestin recruitment (both beta-arrestin 1 and 2).
26852662 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/beta-arrestin 2/Rho A signaling pathway.
26850854 In this study, we aimed to exploit an in vitro model system of BPH in order to better understand the mechanisms of alpha-AR signaling in prostatic hyperplasia.
26829388 a beta-arrestin signalling cycle that is catalytically activated by the GPCR and energetically coupled to the endocytic machinery
26467309 analysis of the crystal structure of the rhodopsin-arrestin complex
26449263 beta-arrestins regulate oxidative stress in a Nox4-dependent manner and increase fibrosis in heart failure.
26372541 Results demonstrate that betaArr2 signaling may be an important pathway for TAAR1 function and that the activation of the TAAR1-D2R complex negatively modulates GSK3b signaling
26371162 In a mouse model of Marfan syndrome, BARR2 contributes to thoracic aortic aneurysm formation by regulating ERK1/2-dependent expression of proaneurysmal genes and proteins downstream of the AT1aR.
26324936 GPCR cell-surface expression is regulated by receptor sequestration in response to beta-arrestin-2 phosphorylation by ERK1/2
More...

AA Sequence

MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLD      1 - 70
VLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKA     71 - 140
CGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYY    141 - 210
HGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLS    211 - 280
DNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPH    281 - 350
DHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC               351 - 409
//

Text Mined References (243)

PMID Year Title
27007855 2016 ?-Arrestin biosensors reveal a rapid, receptor-dependent activation/deactivation cycle.
26957205 2016 Thrombin-Mediated Direct Activation of Proteinase-Activated Receptor-2: Another Target for Thrombin Signaling.
26927499 2016 Contributions of protein kinases and ?-arrestin to termination of protease-activated receptor 2 signaling.
26852662 2016 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/?-arrestin 2/Rho A signaling pathway.
26850854 2016 Biased ?-adrenergic receptor and ?arrestin signaling in a cell culture model of benign prostatic hyperplasia.
26829388 2016 ?-Arrestin drives MAP kinase signalling from clathrin-coated structures after GPCR dissociation.
26467309 2016 A structural snapshot of the rhodopsin-arrestin complex.
26449263 2015 Regulation of mitochondrial oxidative stress by ?-arrestins in cultured human cardiac fibroblasts.
26372541 2015 Trace amine-associated receptor 1 activation silences GSK3? signaling of TAAR1 and D2R heteromers.
26371162 2015 The role of ?-arrestin2-dependent signaling in thoracic aortic aneurysm formation in a murine model of Marfan syndrome.
More...