Property Summary

NCBI Gene PubMed Count 135
PubMed Score 368.40
PubTator Score 229.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 1.925 4.6e-08
acute myeloid leukemia -1.100 5.4e-03
astrocytic glioma 1.600 1.3e-02
chronic lymphosyte leukemia -1.200 6.2e-03
ependymoma 1.700 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.200 9.7e-03
lung cancer 1.800 5.8e-03
malignant mesothelioma -2.500 1.7e-08
Multiple myeloma -1.169 3.4e-02
oligodendroglioma 1.600 7.1e-03
ovarian cancer -1.500 2.4e-03
pancreatic ductal adenocarcinoma liver m... 1.805 1.2e-03
psoriasis 1.100 2.2e-03
tuberculosis 1.500 1.0e-06

 GWAS Trait (1)

Gene RIF (103)

AA Sequence

MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC      1 - 70
EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ     71 - 140
ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN                141 - 198
//

Text Mined References (145)

PMID Year Title