Property Summary

NCBI Gene PubMed Count 122
Grant Count 89
R01 Count 59
Funding $8,209,167.38
PubMed Score 340.77
PubTator Score 229.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.456 0.003
Multiple myeloma -1.169 0.034
malignant mesothelioma -2.500 0.000
astrocytic glioma 1.600 0.013
ependymoma 1.700 0.011
oligodendroglioma 1.600 0.007
psoriasis 1.100 0.002
chronic lymphosyte leukemia -1.200 0.006
tuberculosis 1.500 0.000
pancreatic ductal adenocarcinoma liver m... 1.805 0.001
intraductal papillary-mucinous neoplasm ... 1.200 0.010
lung cancer 1.800 0.006
acute myeloid leukemia -1.100 0.005
ovarian cancer -1.700 0.000

Synonym

Accession P32119 A8K0C0 P31945 P32118 P35701 Q6FHG4 Q92763 Q9UC23
Symbols PRP
TSA
PRX2
PTX1
TPX1
NKEFB
PRXII
TDPX1
NKEF-B
HEL-S-2a

Gene

PANTHER Protein Class (2)

PDB

1QMV  

Gene RIF (92)

PMID Text
26797130 Oxidative stress promotes PRX2 and PRX3 hyperoxidation and attenuates pro-survival signaling in aging chondrocytes.
26614766 the species with one disulfide and one hyperoxidized active site was decameric for Prx2 and dimeric for Prx3. Reduction and re-oxidation of the hyperoxidized dimer of Prx3 produced hyperoxidized monomers
26601956 Prx2 glutathionylation is a favorable reaction that can occur in cells under oxidative stress and may have a role in redox signaling. GSH/Grx1 provide an alternative mechanism to thioredoxin and thioredoxin reductase for Prx2 recycling.
26548861 Data show the protein partners of human Prx1 and Prx2 and identified three sequence motifs, or combination thereof in Prxs partners, namely: CXXC, PXXP, and LXXLL. that can be important for protein localization, function and biological pathways. [review]
26021759 Prx II has an important role in cancer cell survival via the modulation of signaling molecules involved in apoptosis and the phosphorylation of JNK by the downregulation of reactive oxygen species levels in A549/GR cells.
25786472 Functional roles of catalase, PRDX2 and GPX1 during oxidative stress in human erythrocytes.
25471788 Further conclusion showed that Prdx2 regulates VM formation by targeting VEGFR2 activation, which now represents as a therapeutic target for RC.
25323516 two placental proteins, Prx3 and Prx4, may act as new placental immune targets.
25264713 Prx-2 activity is compromised during red blood cell storage.
25221425 Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis.
More...

AA Sequence

MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC      1 - 70
EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ     71 - 140
ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN                141 - 198
//

Text Mined References (130)

PMID Year Title
26797130 2016 Oxidative Stress Promotes Peroxiredoxin Hyperoxidation and Attenuates Pro-survival Signaling in Aging Chondrocytes.
26614766 2016 Kinetic analysis of structural influences on the susceptibility of peroxiredoxins 2 and 3 to hyperoxidation.
26601956 2016 Glutathionylation of the Active Site Cysteines of Peroxiredoxin 2 and Recycling by Glutaredoxin.
26548861 2016 Human Peroxiredoxins 1 and 2 and Their Interacting Protein Partners; Through Structure Toward Functions of Biological Complexes.
26021759 2015 An important role for peroxiredoxin II in survival of A549 lung cancer cells resistant to gefitinib.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25786472 2015 Peroxiredoxin 2, glutathione peroxidase, and catalase in the cytosol and membrane of erythrocytes under H2O2-induced oxidative stress.
25471788 2015 Peroxiredoxin 2 is involved in vasculogenic mimicry formation by targeting VEGFR2 activation in colorectal cancer.
25323516 2015 Preoxiredoxin family members (Prx3 and Prx4) and pregnancy disorder (recurrent pregnancy loss).
25264713 2015 Peroxiredoxin-2 recycling is inhibited during erythrocyte storage.
More...