Property Summary

NCBI Gene PubMed Count 212
PubMed Score 466.26
PubTator Score 867.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 4.48824907019948E-16
malignant mesothelioma 3163 4.44301577467614E-9
glioblastoma 5572 3.94325033610179E-7
pediatric high grade glioma 2712 7.50563142792679E-7
atypical teratoid / rhabdoid tumor 4369 3.18499552773981E-6
pilocytic astrocytoma 3086 5.15238274622142E-6
colon cancer 1475 3.09136696192767E-4
osteosarcoma 7933 5.72434340120073E-4
oligodendroglioma 2849 5.91137469651362E-4
ovarian cancer 8492 8.35495423932998E-4
astrocytic glioma 2241 0.00204531934271855
interstitial cystitis 2299 0.00804126364424715
aldosterone-producing adenoma 664 0.00869677123091532
sonic hedgehog group medulloblastoma 1482 0.0228608651749416
subependymal giant cell astrocytoma 2287 0.0368806790602989
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (15)

Synonym

Accession P32004 A0AV65 A4ZYW4 B2RMU7 G3XAF4 Q8TA87 N-CAM-L1
Symbols S10
HSAS
MASA
MIC5
SPG1
CAML1
CD171
HSAS1
N-CAML1
NCAM-L1
N-CAM-L1

Gene

  Ortholog (11)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (134)

PMID Text
26933044 L1CAM is frequently expressed in testicular germ cell tumors but not in normal testis.
26761817 the CE7-epitope of L1-CAM is a cell adhesion molecule aberrantly expressed in several cancers and may have a role in immunotherapy
26743472 Report high frequency of L1CAM expression in high-risk endometrial cancers associated with mutant p53 expression.
26478212 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets
26464672 Our results suggest that the overexpression of L1CAM may be related to several established markers of poor prognosis in breast cancer patients.
26399194 Genes induced during L1-mediated colorectal cancer cell metastasis
25948108 L1 syndrome should be considered in the differential diagnosis of intellectual disability or mental retardation in children, especially when other signs such as hydrocephalus or adducted thumbs are present.
25934484 novel missense variant in L1CAM was identified in two Caucasian families with mild-moderate intellectual disability without obvious L1 syndrome features
25860483 Our findings establish Slug-induced L1CAM expression as a mediator of a chemoresistant and migratory phenotype in pancreatic adenocarcinoma cells.
25666757 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes L1CAM.
More...

AA Sequence

MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWT      1 - 70
RDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMAEGAPKWPK     71 - 140
ETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIKQDERVTMGQNGNLYFANVLTSDNHSDYICH    141 - 210
AHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPS    211 - 280
GPMPADRVTYQNHNKTLQLLKVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETA    281 - 350
RLDCQVQGRPQPEVTWRINGIPVEELAKDQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIY    351 - 420
VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANGTLGIRDLQAN    421 - 490
DTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQASFDPSLQPSITWRGDGRDL    491 - 560
QELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPGPVPRLVLSDLHLLTQSQ    561 - 630
VRVSWSPAEDHNAPIEKYDIEFEDKEMAPEKWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEP    631 - 700
SPVSETVVTPEAAPEKNPVDVKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQIVSD    701 - 770
PFLVVSNTSTFVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQ    771 - 840
VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNGRGSGPASEFT    841 - 910
FSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDEGGKGQLSFNLRDPELRTHNL    911 - 980
TDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHIL    981 - 1050
FKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE   1051 - 1120
GWFIGFVSAIILLLLVLLILCFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGS   1121 - 1190
SQPSLNGDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE      1191 - 1257
//

Text Mined References (218)

PMID Year Title
26933044 2016 L1-CAM is commonly expressed in testicular germ cell tumours.
26761817 2016 L1 Cell Adhesion Molecule-Specific Chimeric Antigen Receptor-Redirected Human T Cells Exhibit Specific and Efficient Antitumor Activity against Human Ovarian Cancer in Mice.
26743472 2016 Prognostic significance of L1CAM expression and its association with mutant p53 expression in high-risk endometrial cancer.
26478212 2015 L1-CAM and N-CAM: From Adhesion Proteins to Pharmacological Targets.
26464672 2015 Overexpression of L1 cell adhesion molecule correlates with aggressive tumor progression of patients with breast cancer and promotes motility of breast cancer cells.
26399194 2015 Clusterin, a gene enriched in intestinal stem cells, is required for L1-mediated colon cancer metastasis.
25948108 2015 Three cases with L1 syndrome and two novel mutations in the L1CAM gene.
25934484 Identical by descent L1CAM mutation in two apparently unrelated families with intellectual disability without L1 syndrome.
25860483 2015 Slug-dependent upregulation of L1CAM is responsible for the increased invasion potential of pancreatic cancer cells following long-term 5-FU treatment.
25666757 2015 Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy.
More...