Property Summary

NCBI Gene PubMed Count 27
PubMed Score 182.93
PubTator Score 155.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
hepatocellular carcinoma 1.200 2.2e-02
lung cancer -1.100 1.0e-02
mucosa-associated lymphoid tissue lympho... 4.090 1.4e-02
osteosarcoma -8.076 1.6e-12
tuberculosis 1.600 3.6e-02

Gene RIF (10)

AA Sequence

MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKG      1 - 70
ETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSV     71 - 140
HPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDV    141 - 210
GPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY    211 - 280
TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI     281 - 349
//

Text Mined References (27)

PMID Year Title