Property Summary

NCBI Gene PubMed Count 25
Grant Count 4
R01 Count 4
Funding $205,991.86
PubMed Score 172.05
PubTator Score 155.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.022
osteosarcoma -8.076 0.000
tuberculosis 1.600 0.036
lung cancer -1.100 0.010
diabetes mellitus 1.100 0.001
mucosa-associated lymphoid tissue lympho... 4.090 0.014

Synonym

Accession P31997 O60399 Q16574
Symbols CD67
CGM6
CD66b
NCA-95

Gene

PDB

4WTZ   4YIQ   2DKS   4Y88  

Gene RIF (8)

PMID Text
26483485 Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another.
26176669 Inhibition of C5aR1 leads to a significant reduction of CD66b and CD11b expression indicating a lower neutrophil activation status and block of granule exocytosis.
24743304 CEACAM8 interacts with CEACAM1 inhibiting TLR2-triggered immune responses
23686079 Granulocytes from type 2 diabetes patients display higher granulocyte cell surface expression of CD66b compared with values of healthy controls.
21470677 The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation.
19077207 Data show that desensitization of neutrophils to any two CEACAMs, 1, 3, 6, or 8, results in selective desensitization to those two CEACAMs, while the cells remain responsive to the other two neutrophil CEACAMs.
18056392 CD66b molecules are involved in regulating adhesion and activation of eosinophils, possibly through their localization in lipid rafts and interaction with other cell surface molecules, such as CD11b.
17909799 All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes.

AA Sequence

MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKG      1 - 70
ETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSV     71 - 140
HPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDV    141 - 210
GPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY    211 - 280
TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI     281 - 349
//

Text Mined References (25)

PMID Year Title
26483485 2015 Diverse oligomeric states of CEACAM IgV domains.
26176669 2015 CD66b Overexpression and Loss of C5a Receptors as Surface Markers for Staphylococcus aureus-Induced Neutrophil Dysfunction.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
24743304 2014 Soluble CEACAM8 interacts with CEACAM1 inhibiting TLR2-triggered immune responses.
23686079 2013 Fasting glucose level modulates cell surface expression of CD11b and CD66b in granulocytes and monocytes of patients with type 2 diabetes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21470677 2011 High expression of carcinoembryonic antigen-related cell adhesion molecule (CEACAM) 6 and 8 in primary myelofibrosis.
19077207 2008 Interdependency of CEACAM-1, -3, -6, and -8 induced human neutrophil adhesion to endothelial cells.
18056392 2007 CD66b regulates adhesion and activation of human eosinophils.
17909799 2008 High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias.
More...