Property Summary

NCBI Gene PubMed Count 180
PubMed Score 619.43
PubTator Score 315.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.100 1.1e-02
colon cancer -1.300 2.5e-02
glioblastoma 2.200 4.6e-02
interstitial cystitis 1.500 5.9e-04
intraductal papillary-mucinous adenoma (... -1.200 8.9e-04
intraductal papillary-mucinous carcinoma... -1.600 3.8e-04
intraductal papillary-mucinous neoplasm ... -1.600 2.2e-03
invasive ductal carcinoma 2.062 1.1e-06
lung cancer -1.100 5.6e-03
lung carcinoma -1.700 6.6e-15
mucosa-associated lymphoid tissue lympho... 1.320 1.0e-02
ovarian cancer -1.800 2.8e-05
pancreatic ductal adenocarcinoma liver m... -1.248 2.7e-02
periodontitis 1.300 1.4e-23
primary Sjogren syndrome 1.800 1.6e-05
psoriasis -1.100 1.7e-02
tuberculosis 1.500 2.6e-04
ulcerative colitis 2.300 1.8e-04

 CSPA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (165)

AA Sequence

MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLT      1 - 70
CRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHL     71 - 140
EFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPV    141 - 210
TITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDE    211 - 280
ADKVGAENTITYSLLMHPDALEEPDDQNRI                                            281 - 310
//

Text Mined References (183)

PMID Year Title