Property Summary

NCBI Gene PubMed Count 172
PubMed Score 595.17
PubTator Score 315.63

Knowledge Summary


No data available



Accession P31994 A6H8N3 O95649 Q53X85 Q5VXA9 Q8NIA1 IgG Fc receptor II-b
Symbols CD32



2FCB   3WJJ  

Gene RIF (158)

26748351 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26694610 LPS activation of TLR4 significantly increased MARCH3 expression and that siRNA against MARCH3 prevented the decrease in FcgammaRIIb following LPS treatment.
26475492 FcgammaRIIB requires Btk and p38 MAPK to mediate antigen-independent inhibition in human B cells.
26133275 a rare FCGR2B null-variant allele was found, in which a polymorphic stop codon of FCGR2C is introduced into one FCGR2B gene
26084639 FcgammaRIIB rs12117530 polymorphism is associated with disease risk and clinical manifestations of Systemic Lupus Erythematosus in Koreans.
25823782 none of the three functional polymorphisms in FcgammaR genes explored here, the FCGR3A F158V and FCGR2B I232T nsSNPs and the VNTR in FCGRT, showed an association with the response to TNFi in patients with rheumatoid arthritis
25821224 FcgammaRIIB prevents inflammatory type I IFN production from plasmacytoid dendritic cells during a viral memory response.
25670392 The study provides evidence for FcgammaRs, especially FcgammaRIIB, being involved in the pathogenesis of Hashimoto's thyroiditis.
25630523 The FCGR2B variant leads to reduced serum IL-6, later disease onset and reduced need for biological treatment, but does not seem to aggravate RA. The TM region variant is associated with a lower activation state of the Tregs and naive and memory B cells.
25568316 Data indicate that Fcgamma receptors FcgammaRIIb and FcgammaRIIa may play a structural role in augmenting CD20 internalization.

AA Sequence

ADKVGAENTITYSLLMHPDALEEPDDQNRI                                            281 - 310

Publication (175)

PMID Year Title
26748351 2016 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26694610 2016 Toll-like Receptor 4 Ligands Down-regulate Fc? Receptor IIb (Fc?RIIb) via MARCH3 Protein-mediated Ubiquitination.
26475492 2015 Fc?RIIB mediates antigen-independent inhibition on human B lymphocytes through Btk and p38 MAPK.
26133275 2015 Nonallelic homologous recombination of the FCGR2/3 locus results in copy number variation and novel chimeric FCGR2 genes with aberrant functional expression.
26084639 2015 Fc?RIIB Gene Polymorphisms Are Associated with Disease Risk and Clinical Manifestations of Systemic Lupus Erythematosus in Koreans.
25823782 2015 FCGR polymorphisms in the treatment of rheumatoid arthritis with Fc-containing TNF inhibitors.
25821224 2015 Fc?RIIB prevents inflammatory type I IFN production from plasmacytoid dendritic cells during a viral memory response.
25670392 2015 The expression of Fc? receptors in Hashimoto's thyroiditis.
25630523 2015 The presence of FCGR2B promoter or transmembrane region variant alleles leads to reduced serum IL-6 levels in rheumatoid arthritis.
25568316 2015 Activatory and inhibitory Fc? receptors augment rituximab-mediated internalization of CD20 independent of signaling via the cytoplasmic domain.