Property Summary

NCBI Gene PubMed Count 69
PubMed Score 110.02
PubTator Score 93.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2499 3.682 1.8

Expression

Gene RIF (43)

AA Sequence

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN      1 - 70
SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT                                        71 - 105
//

Text Mined References (77)

PMID Year Title