Property Summary

NCBI Gene PubMed Count 65
Grant Count 20
R01 Count 17
Funding $839,297.64
PubMed Score 102.48
PubTator Score 93.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (40)

PMID Text
26544866 the up-regulation of S100A11 plays a role in tumor progression, particularly in KRAS-mutated lung adenocarcinomas
26472670 higher S100A11 expression was associated with statistically significant decrease in disease-free survival in clear cell renal cell carcinoma
24806074 metastatic cancer cells have elevated rate of cell injury and they rely on the S100A11-ANXA2 complex to enable cell membrane repair. S100A11 in a complex with Annexin A2 helps reseal the plasma membrane.
24631019 Proteomic data suggest a limited protein set is involved in SET- (template activating factor-I-) mediated cytotoxicity of TCE (trichloroethylene) in hepatocytes; this set includes CFL1 (cofilin 1), PRDX2 (peroxiredoxin 2), and S100-A11 (calgizzarin).
24376686 The EGFRvIII-STAT3 pathway promotes cell migration and invasion by upregulating S100A11 in hepatocellular carcinoma.
23928665 Our data indicate that S100A11 overexpression exerts a protumoral functional role in papillary thyroid carcinoma pathogenesis.
23745637 Data suggest that S100A11 is involved in maintenance of p21-CIP1 (cyclin-dependent kinase inhibitor 1A) protein stability (up-regulation; down-regulation) and appears to function as inhibitor of apoptosis in keratinocytes.
22903637 the structure of human calcium-bound S100A11.
22869607 Endometrial S100A11 is a crucial intermediator in EGF-stimulated embryo adhesion, endometrium receptivity, and immunotolerance via affecting Ca2+ uptake and release from intracellular Ca2+ stores.
22430872 All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis.
More...

AA Sequence

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN      1 - 70
SDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT                                        71 - 105
//

Text Mined References (73)

PMID Year Title
26544866 2015 Up-Regulation of S100A11 in Lung Adenocarcinoma - Its Potential Relationship with Cancer Progression.
26472670 2016 S100A11 is a potential prognostic marker for clear cell renal cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24806074 2014 S100A11 is required for efficient plasma membrane repair and survival of invasive cancer cells.
24631019 2014 Identification of the proteins related to SET-mediated hepatic cytotoxicity of trichloroethylene by proteomic analysis.
24376686 2013 EGFRvIII mediates hepatocellular carcinoma cell invasion by promoting S100 calcium binding protein A11 expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23928665 2013 S100A11 overexpression contributes to the malignant phenotype of papillary thyroid carcinoma.
23745637 2013 S100A11 is involved in the regulation of the stability of cell cycle regulator p21(CIP1/WAF1) in human keratinocyte HaCaT cells.
More...