Property Summary

NCBI Gene PubMed Count 56
Grant Count 91
R01 Count 62
Funding $8,540,549.66
PubMed Score 103.60
PubTator Score 77.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.800 0.012
malignant mesothelioma 1.600 0.000
psoriasis -3.100 0.000
non-small cell lung cancer 1.411 0.000
lung cancer 1.800 0.000
colon cancer 1.100 0.017
lung adenocarcinoma 1.587 0.000
breast carcinoma 1.200 0.000
invasive ductal carcinoma 1.600 0.000
Gaucher disease type 1 -1.600 0.025
dermatomyositis -1.200 0.001

Synonym

Accession P31948 B4DM70 F5H0T1 G3XAD8 Q3ZCU9 Q5TZU9 STI1
Symbols HOP
P60
STI1
STI1L
HEL-S-94n
IEF-SSP-3521

Gene

PANTHER Protein Class (1)

PDB

1ELR   1ELW   2LNI   3ESK   3FWV  

Gene RIF (29)

PMID Text
25311551 Stip1 has a role in the male reproductive system and is expressed during the stress response
25034945 Data confirmed the significant up-regulation of STIP1 in tumorous cholangiocytes relative to normal hepatocytes and non-tumorous cells and show prooved it as a reliable diagnostic biomarker when using immunohistochemistry.
25010044 STIP1 and moesin may be novel and differential sero-diagnostic markers for psoriasis vulgaris and psoriatic arthritis
24535459 These results indicate that HOP is a unique co-chaperone that undergoes an ATP-dependent conformational change.
24488757 Increased STIP1 expression is associated with poor survival outcome in epithelial ovarian cancer (EOC), and STIP1 may represent a useful therapeutic target in EOC patients.
24163084 our findings provide evidences that positive expression of STIP1 in papillary thyroid carcinoma may be important in the acquisition of an aggressive phenotype
23915849 STIP1 histoscores may be useful in detecting invasive human ovarian cancer in patients with low serum CA125 levels.
23836498 stress-inducible protein-1 has a role in recruitment of bone marrow derived cells into the ischemic brains
23166591 Expression of HIV-1 Tat upregulates the abundance of stress-induced-phosphoprotein 1 (STIP1) in the nucleoli of Jurkat T-cells
22884369 Luminal iron levels govern intestinal tumorigenesis after Apc loss in vivo.
More...

AA Sequence

MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD      1 - 70
WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD     71 - 140
PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK    141 - 210
PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE    211 - 280
LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE    281 - 350
RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC    351 - 420
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM    421 - 490
ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR                     491 - 543
//

Text Mined References (73)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25311551 2015 Systematic study of stress-inducible protein 1 (Stip1) in male reproductive system and its expression during stress response.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25034945 2014 Identification of novel biomarker candidates for the immunohistochemical diagnosis of cholangiocellular carcinoma.
25010044 2014 Moesin and stress-induced phosphoprotein-1 are possible sero-diagnostic markers of psoriasis.
24880080 2014 SMYD2-dependent HSP90 methylation promotes cancer cell proliferation by regulating the chaperone complex formation.
More...