Property Summary

NCBI Gene PubMed Count 67
PubMed Score 110.80
PubTator Score 77.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count
Depressive disorder 409
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.1
Disease Target Count Z-score Confidence
Bile duct adenoma 3 3.493 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma 1.200 9.0e-14
colon cancer 1.100 1.7e-02
dermatomyositis -1.200 1.2e-03
Gaucher disease type 1 -1.600 2.5e-02
invasive ductal carcinoma 1.600 2.9e-04
lung adenocarcinoma 1.587 5.5e-08
lung cancer 1.300 8.7e-04
malignant mesothelioma 1.200 3.6e-06
non-small cell lung cancer 1.411 8.5e-10
psoriasis 1.400 7.3e-05
Rheumatoid arthritis -1.800 1.2e-02

Protein-protein Interaction (6)

Gene RIF (36)

AA Sequence

MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD      1 - 70
WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD     71 - 140
PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK    141 - 210
PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE    211 - 280
LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE    281 - 350
RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC    351 - 420
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM    421 - 490
ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR                     491 - 543
//

Text Mined References (84)

PMID Year Title