Property Summary

NCBI Gene PubMed Count 161
PubMed Score 375.75
PubTator Score 175.69

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 7.72781629786097E-15
non-small cell lung cancer 2798 7.62205643141286E-11
pancreatic cancer 2300 3.99735462820156E-8
cystic fibrosis 1670 1.0045209142301E-7
posterior fossa group A ependymoma 1511 4.96873445720512E-7
malignant mesothelioma 3163 8.00458013321326E-6
psoriasis 6685 9.50703490606244E-5
medulloblastoma, large-cell 6234 1.01521584956613E-4
atypical teratoid / rhabdoid tumor 4369 1.1896785295622E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.80607662677981E-4
ovarian cancer 8492 8.19440039984815E-4
diabetes mellitus 1663 0.00116068310808949
osteosarcoma 7933 0.00182225950459642
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00649307951246336
lung cancer 4473 0.00675839932938418
sarcoidosis 368 0.00767321080579779
adult high grade glioma 2148 0.0085469942957725
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00969688948850281
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0162516700806196
ductal carcinoma in situ 1745 0.01640991461294
Breast cancer 3099 0.0383557996892574
spina bifida 1064 0.0390283710096485
interstitial cystitis 2299 0.0425116617294271
Disease Target Count Z-score Confidence
Cancer 2346 4.778 2.4
Popliteal pterygium syndrome 6 3.18 1.6



Accession P31947 Q6FH30 Q6FH51 Q96DH0
Symbols YWHAS



PANTHER Protein Class (1)


4JC3   4JDD   3LW1   1YWT   1YZ5   3IQJ   3IQU   3IQV   3MHR   3O8I   3P1N   3P1O   3P1P   3P1Q   3P1R   3P1S   3SMK   3SML   3SMM   3SMN   3SMO   3SP5   3SPR   3T0L   3T0M   3U9X   3UX0   4DAT   4DAU   4DHM   4DHN   4DHO   4DHP   4DHQ   4DHR   4DHS   4DHT   4DHU   4FL5   4FR3   4HQW   4HRU   4IEA   4QLI   4Y32   4Y3B   4Y5I   5BTV   5HF3  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (106)

26223682 These results suggest that SFN facilitates lung tumor development and progression. SFN appears to be a novel oncogene with potential as a therapeutic target
26179207 SFN regulates cancer metabolic reprogramming. It opposes tumor-promoting metabolic programs by enhancing c-Myc poly-ubiquitination and degradation. SFN suppresses cancer glycolysis, glutaminolysis, and mitochondrial biogenesis.
26103986 Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein.
25736868 K17 expression is accompanied by cytoplasmic expression of 14-3-3 sigma, indicative of their functional relationship in oral squamous cell carcinoma
25234834 SFN affects the water-holding capacity, barrier function and dermal matrix components in photoaging skin. An increase of SFN triggered by UVB irradiation may be one of the causes of alterations observed in photoaging skin.
24923353 14-3-3sigma alone or combined with HSP70 are potential prognostic biomarkers for HCC
24469038 Results suggest a role of Wig-1 as a survival factor that directs the p53 stress response toward cell cycle arrest rather than apoptosis through the regulation of FAS and 14-3-3sigma mRNA levels.
24234332 Cdc25B upregulation and 14-3-3sigma downregulation might promote development of bladder cancer and suggested a poor prognosis.
24201220 Decreased expression of immunoreactive 14-3-3sigma may be a predictor of poor prognosis in patients with uterine papillary serous carcinoma.
24124604 stratifin plays a role in regulating plakophilin-3 incorporation into the desmosomal plaque by forming a plakophilin-3 stratifin complex in the cytosol and thereby affecting desmosome dynamics in squamous epithelial cells.

AA Sequence

DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS                                    211 - 248

Text Mined References (168)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26223682 2015 Stratifin accelerates progression of lung adenocarcinoma at an early stage.
26179207 2015 The cell cycle regulator 14-3-3? opposes and reverses cancer metabolic reprogramming.
26103986 2015 Involvement of 14-3-3 in tubulin instability and impaired axon development is mediated by Tau.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25736868 2015 Keratin 17 is co-expressed with 14-3-3 sigma in oral carcinoma in situ and squamous cell carcinoma and modulates cell proliferation and size but not cell migration.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25234834 2014 Increase of stratifin triggered by ultraviolet irradiation is possibly related to premature aging of human skin.