Property Summary

NCBI Gene PubMed Count 185
Grant Count 17
R01 Count 14
Funding $654,761.85
PubMed Score 102.38
PubTator Score 30.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (55)

PMID Text
26730736 Data show that 14-3-3beta protein augmented the expression of matrix metalloproteinasea MMP2 and MMP9 through PI3 kinase/Akt protein/NF-kappaappa B pathway, thereby enhancing the invasiveness of hepatocellular carcinoma (HCC) cells.
26260846 These findings indicate that 14-3-3beta and gamma are novel PPARgamma2 regulators and are involved in hepatic lipid metabolism. 14-3-3b and gamma can be therapeutic target molecules to treat non-alcoholic fatty liver disease.
25228695 miR-152 controls both the expression of 14-3-3beta and HLA-G and exerts a dual role in tumor cells by both altering the immunogenicity and the tumorigenicity
24636949 Crystal structure of Myo1c/14-3-3beta complex, which has been implicated in the exocytosis of glucose transporter 4 storage vesicles during insulin-stimulated glucose uptake.
24555778 Data suggest that serum 14-3-3beta concentrations may constitute a useful marker for blood brain barrier damage severity and follow up in patients with eosinophilic meningitis caused by Angiostrongylus cantonensis.
24269229 Data identified three classes of 14-3-3 targets that all have two binding sites, but displayed synergistic interaction between converging signalling pathways for different ranges of parameter values.
24038028 Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner.
23053962 These results indicate that the six YWHAB polymorphisms are not associated with the genetic susceptibility to sporadic Creutzfeldt-Jakob disease.
22278744 14-3-3beta binding to phosphorylated CFTR augments its biogenesis by reducing retrograde retrieval of CFTR to the endoplasmic reticulum. This mechanism permits cAMP/PKA stimulation to make more CFTR available for anion secretion.
22190034 HIV-1 Vpr inhibits insulin-induced association of 14-3-3 and Foxo3a in HeLa cells
More...

AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK      1 - 70
TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK     71 - 140
QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE    141 - 210
ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN                                      211 - 246
//

Text Mined References (202)

PMID Year Title
26730736 2016 14-3-3? Promotes Migration and Invasion of Human Hepatocellular Carcinoma Cells by Modulating Expression of MMP2 and MMP9 through PI3K/Akt/NF-?B Pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26260846 2015 14-3-3? and ? differentially regulate peroxisome proliferator activated receptor ?2 transactivation and hepatic lipid metabolism.
26047703 2015 Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25228695 2014 Identification of 14-3-3? gene as a novel miR-152 target using a proteome-based approach.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24636949 2014 Crystal structure of human myosin 1c--the motor in GLUT4 exocytosis: implications for Ca2+ regulation and 14-3-3 binding.
More...