Property Summary

Ligand Count 1
NCBI Gene PubMed Count 192
PubMed Score 109.13
PubTator Score 30.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 2.3e-04
astrocytic glioma -1.500 2.1e-02
atypical teratoid / rhabdoid tumor -1.600 1.6e-06
colon cancer 1.400 1.5e-02
dermatomyositis 1.100 3.5e-03
diabetes mellitus -1.100 1.4e-03
glioblastoma -1.700 2.0e-03
intraductal papillary-mucinous adenoma (... 1.100 1.9e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.7e-02
juvenile dermatomyositis 1.037 9.8e-11
limb girdle muscular dystrophy 2I -1.034 3.0e-03
lung adenocarcinoma 1.186 7.9e-06
medulloblastoma -1.100 1.2e-04
medulloblastoma, large-cell -1.200 1.0e-04
osteosarcoma -1.264 5.7e-05
ovarian cancer -1.300 6.9e-04
pancreatic cancer 1.200 4.0e-02
Parkinson's disease -1.500 4.3e-02
primary pancreatic ductal adenocarcinoma 1.002 3.7e-03
Waldenstrons macroglobulinemia 1.157 1.5e-02

Protein-protein Interaction (3)

Gene RIF (54)

AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQK      1 - 70
TERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNK     71 - 140
QTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNE    141 - 210
ESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN                                      211 - 246
//

Text Mined References (209)

PMID Year Title