Property Summary

NCBI Gene PubMed Count 54
Grant Count 15
R01 Count 12
Funding $994,533.54
PubMed Score 72.36
PubTator Score 75.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.002

Gene RIF (38)

PMID Text
25651379 overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14
25315296 Caspase-14 was decreased in inflammatory lesions compared to non-lesion in atopic dermatitis. The amount of caspase-14 in the lesions correlated with clinical severity as determined by eczema area and severity index score and the skin barrier functions.
25121097 caspase-14 contributes to retinal pigment epithelium cell barrier disruption under hyperglycemic conditions.
24872419 Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models.
23645350 partial loss of caspase 14 is not associated with dedifferentiation in neoplastic lesions of the oral mucosa
23580611 Results suggest that caspase-14 may interact with GCM1 to participate in syncytiotrophoblast differentiation during placental development.
23408445 genetic polymorphisms in AICDA and CASP14 are associated with risk for brain tumor in Korean children.
23377137 Suggest caspase-14 is a marker of human skin differentiation during development.
23362869 ceramides, an important structural lipid, stimulate caspase-14 expression, coordinating formation of lipid lamellar membranes with the formation of corneocytes
22876114 Caspase-14 might play a significant role in the pathogenesis of diabetic retinopathy by accelerating retinal endothelial and epithelial cells death.
More...

AA Sequence

MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQ      1 - 70
AIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPG     71 - 140
ETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVT    141 - 210
RRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ                                          211 - 242
//

Text Mined References (56)

PMID Year Title
25651379 2015 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation through GATA-3/caspase-14 pathway in A431 cells.
25416956 2014 A proteome-scale map of the human interactome network.
25315296 2014 Pyrrolidone carboxylic acid levels or caspase-14 expression in the corneocytes of lesional skin correlates with clinical severity, skin barrier function and lesional inflammation in atopic dermatitis.
25121097 2014 Caspase-14 expression impairs retinal pigment epithelium barrier function: potential role in diabetic macular edema.
24872419 2014 Mesotrypsin and caspase-14 participate in prosaposin processing: potential relevance to epidermal permeability barrier formation.
24743736 2014 Multiple pathways are involved in DNA degradation during keratinocyte terminal differentiation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23645350 2013 Expression of caspase 14 and filaggrin in oral squamous carcinoma.
23580611 2013 Caspase-14 suppresses GCM1 acetylation and inhibits placental cell differentiation.
23408445 2013 Genetic variants of AICDA/CASP14 associated with childhood brain tumor.
More...