Property Summary

NCBI Gene PubMed Count 62
PubMed Score 50.88
PubTator Score 25.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.220 6.4e-05
aldosterone-producing adenoma -1.675 7.9e-03
astrocytoma 1.300 1.7e-02
Atopic dermatitis 1.900 1.2e-02
autosomal dominant Emery-Dreifuss muscul... 1.222 2.3e-03
cystic fibrosis -1.185 1.4e-03
ependymoma 1.200 4.6e-02
glioblastoma 1.200 2.6e-02
group 3 medulloblastoma 2.600 1.8e-03
intraductal papillary-mucinous adenoma (... 1.100 2.3e-03
medulloblastoma, large-cell 1.400 2.3e-04
osteosarcoma 2.169 6.6e-04
ovarian cancer -1.600 7.2e-06
Pick disease -1.400 2.8e-04
progressive supranuclear palsy -1.200 3.9e-02
psoriasis -1.300 1.7e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (29)

AA Sequence

MMLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLA      1 - 70
LKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG     71 - 140
ITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY    141 - 210
DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG    211 - 280
STFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKA    281 - 350
NMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY    351 - 420
GGGYGGQSSMSGYDQVLQENSSDFQSNIA                                             421 - 449
//

Text Mined References (75)

PMID Year Title