Property Summary

NCBI Gene PubMed Count 29
PubMed Score 62.33
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25496916 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24690621 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23125841 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23125841 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23125841 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23125841 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22190034 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22174317 Heterogeneous nuclear ribonucleoprotein H3 (HNRNPH3) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
20943442 Using ORF phage display, heterogeneous nuclear ribonucleoprotein H3 (Hnrph3) was, among other candidates, identified as an autoantigen for acute anterior uveitis.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIA      1 - 70
ENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGG     71 - 140
DGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATEND    141 - 210
IANFFSPLNPIRVHIDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGS    211 - 280
GMGGYGRDGMDNQGGYGSVGRMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY        281 - 346
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22446626 2012 DBIRD complex integrates alternative mRNA splicing with RNA polymerase II transcript elongation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
More...