Property Summary

NCBI Gene PubMed Count 29
PubMed Score 63.39
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (7)

AA Sequence

MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEAFVQFASKEIA      1 - 70
ENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGG     71 - 140
DGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATEND    141 - 210
IANFFSPLNPIRVHIDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGS    211 - 280
GMGGYGRDGMDNQGGYGSVGRMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY        281 - 346
//

Text Mined References (42)

PMID Year Title