Property Summary

NCBI Gene PubMed Count 81
PubMed Score 52.44
PubTator Score 63.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis 1.600 5.2e-03
chronic lymphosyte leukemia -1.400 1.1e-07
cutaneous lupus erythematosus 3.000 4.3e-03
dermatomyositis 1.200 7.3e-03
interstitial cystitis 1.600 1.2e-02
juvenile dermatomyositis 1.310 3.4e-06
lung adenocarcinoma -1.056 8.9e-06
lung cancer -1.400 5.6e-03
lung carcinoma -1.700 2.6e-07
mucosa-associated lymphoid tissue lympho... 1.430 2.3e-02
osteosarcoma -3.264 2.1e-03
psoriasis 1.200 1.4e-03
tuberculosis 2.500 1.2e-02

Gene RIF (69)

AA Sequence

MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRH      1 - 70
AELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEAL     71 - 140
QMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN               141 - 199
//

Text Mined References (87)

PMID Year Title