Property Summary

NCBI Gene PubMed Count 63
Grant Count 42
R01 Count 23
Funding $4,430,278.8
PubMed Score 40.39
PubTator Score 63.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 4.200 0.000
cutaneous lupus erythematosus 3.000 0.004
osteosarcoma -3.264 0.002
chronic lymphosyte leukemia -1.400 0.000
juvenile dermatomyositis 1.310 0.000
Atopic dermatitis 1.600 0.005
tuberculosis 2.500 0.012
lung cancer -1.400 0.006
interstitial cystitis 2.400 0.001
lung adenocarcinoma -1.056 0.000
lung carcinoma -1.700 0.000
mucosa-associated lymphoid tissue lympho... 1.430 0.023
dermatomyositis 1.200 0.007

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
493011 screening 1373 / 0 / 330488 uHTS identification of APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
493024 summary 0 / 0 / 0 Summary assay for APOBEC3A DNA Deaminase Inhibitors
493151 screening 863 / 0 / 504 Single concentration confirmation of uHTS for APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
504722 confirmatory 6 / 0 / 278 Dose Response confirmation of APOBEC3G DNA Deaminase Inhibitors via a A3A counterscreen
504724 confirmatory 445 / 0 / 3 Dose Response confirmation of small molecule APOBEC3A DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
588857 confirmatory 6 / 0 / 93 SAR analysis of small molecule inhibitors of APOBEC3A DNA Deaminase via a fluorescence-based single-stranded DNA deaminase assay
624089 confirmatory 7 / 0 / 36 SAR analysis of small molecule inhibitors of APOBEC3A DNA Deaminase via a fluorescence-based single-stranded DNA deaminase assay - Set 2

Gene RIF (54)

PMID Text
26320772 Germline variant and deletion polymorphism in APOBEC3A gene are not associated with breast cancer risk.
26258849 APOBEC3A-mediated mutagenesis is much more frequent than APOBEC3B because APOBEC3A itself is highly proficient at generating DNA breaks.
26253512 These results indicate that the mechanisms of APOBEC3 restriction of Koala Retro Virus by humanA3G and mouseA3 differ (deamination dependent vs. independent) and glyco-gag does not play a role in the restriction.
26116899 HIV-1 Vpr upregulates the gene expression of APOBEC3A in human monocyte-derived dendritic cells
25914058 Structural studies show that specific binding of single-stranded DNA is regulated by the cooperative dimerization of APOBEC3A.
25898173 This study demonstrates the cellular RNA editing activity of a member of the APOBEC3 family of innate restriction factors and expands the understanding of C>U RNA editing in mammals.
25807502 The role of APOBEC3A in mediating this change was confirmed by A3A overexpression in Fujioka cells, which led to a significant increase in WT1 c.1303G>A mRNA editing.
25576866 Expression of APOBEC3A or 3C in 293FT cells reduced the infectivity of HPV16 pseudovirions. The reduced infectivity of virions assembled in the presence of APOBEC3A, but not 3C, was attributed to decreased copy number of the encapsidated reporter plasmid.
25355878 Collectively, these findings suggest that APOBEC3A acts as a restriction factor against human papillomavirus infection, but the induction of this restriction mechanism by human papillomavirus may come at a cost to the host by promoting cancer mutagenesis.
25298230 Chimeric A3A mRNA resulting from DeltaA3B was more stable, resulting in higher intracellular A3A levels and greater DNA damage.
More...

AA Sequence

MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRH      1 - 70
AELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEAL     71 - 140
QMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN               141 - 199
//

Publication (69)

PMID Year Title
27643540 2016 Association of germline variants in the APOBEC3 region with cancer risk and enrichment with APOBEC-signature mutations in tumors.
26320772 2016 Impact of functional germline variants and a deletion polymorphism in APOBEC3A and APOBEC3B on breast cancer risk and survival in a Swedish study population.
26258849 2015 An APOBEC3A hypermutation signature is distinguishable from the signature of background mutagenesis by APOBEC3B in human cancers.
26253512 2015 Human and murine APOBEC3s restrict replication of koala retrovirus by different mechanisms.
25914058 2015 The ssDNA Mutator APOBEC3A Is Regulated by Cooperative Dimerization.
25898173 2015 APOBEC3A cytidine deaminase induces RNA editing in monocytes and macrophages.
25807502 2015 APOBEC3A is implicated in a novel class of G-to-A mRNA editing in WT1 transcripts.
25576866 2015 APOBEC3A and 3C decrease human papillomavirus 16 pseudovirion infectivity.
25355878 2015 APOBEC3A functions as a restriction factor of human papillomavirus.
25298230 2014 A prevalent cancer susceptibility APOBEC3A hybrid allele bearing APOBEC3B 3'UTR enhances chromosomal DNA damage.
More...