Property Summary

Ligand Count 7
NCBI Gene PubMed Count 51
PubMed Score 835.03
PubTator Score 191.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.712 1.9
Obesity 678 3.6 1.8
Hyperglycemia 137 3.367 1.7
Vascular disease 319 3.246 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus -1.300 1.4e-03
astrocytoma 1.200 9.3e-03
group 4 medulloblastoma -1.200 1.7e-04
lung cancer 1.900 6.4e-04
medulloblastoma, large-cell 1.200 2.7e-03
Multiple myeloma 1.572 9.4e-04
non-small cell lung cancer 1.023 1.1e-20
ovarian cancer 1.900 3.1e-05

 GWAS Trait (1)

Gene RIF (36)

AA Sequence

MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHP      1 - 70
AVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHA     71 - 140
RVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGM    141 - 210
NPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLS    211 - 280
EDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEA    281 - 350
LTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV    351 - 420
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNA    421 - 490
IDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIA    491 - 560
APSGSAADKVVIEACDELGIILAHTNLRLFHH                                          561 - 592
//

Text Mined References (59)

PMID Year Title