Property Summary

NCBI Gene PubMed Count 49
Grant Count 142
R01 Count 87
Funding $17,243,171.8
PubMed Score 787.35
PubTator Score 191.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.572 0.001
astrocytoma 1.200 0.009
medulloblastoma, large-cell 1.200 0.003
non-small cell lung cancer 1.023 0.000
lung cancer 2.500 0.000
diabetes mellitus -1.300 0.001
group 4 medulloblastoma -1.200 0.000
ovarian cancer 1.900 0.000

Synonym

Accession P31939 A8K202 E9PBU3 Q13856 Q53S28
Symbols PURH
AICAR
AICARFT
IMPCHASE
HEL-S-70p

Gene

PANTHER Protein Class (2)

PDB

1P4R   1PKX   1PL0  

Gene RIF (34)

PMID Text
26799664 ATIC 347C>G gene polymorphism may be associated with the development of MTX induced gastrointestinal adverse events.
25823786 This study shows that polymorphisms on genes related to the metabolic pathway of pemetrexed, especially, ATIC and GGH genes, would have a therapeutic implication in pemetrexed-treated patients with lung adenocarcinoma
25687571 PTPLAD1 and AMPK are rapidly compartmentalized within the plasma membrane (PM) and Golgi/endosome fractions after insulin stimulation and that ATIC later accumulates in the Golgi/endosome fraction.
25687571 Our data show that ATIC is in complex with insulin receptor (IR)and siRNA-mediated partial knockdown of ATIC in HEK293 cells, decreases IR tyrosine phosphorylation and regulates IR endocytosis. Insulin stimulation and ATIC knockdown readily increase level of AMPK-Thr172 phosphorylation in IR complexes.ATIC depletion delayed insulin response of Glut2 translocation in HEK293 cells and decreased AKT-Ser473 phosphorylation.
25425682 Single nucleotide polymorphisms in ATIC gene is associated with acute graft-versus-host disease.
25240429 genotyping of ATIC rs2372536 and ITPA rs1127354 variants or measuring ITPA activity could be useful to predict methotrexate response in children with juvenile idiopathic arthritis.
25084201 MTHFR, DHFR and ATIC genetic variants can be considered as pharmacogenetic markers of outcome in RA patients under MTX monotherapy.
24967362 study suggests that MTHFR C677T and ATIC T675C genotyping combined with clinicopathological data may help to identify patients whom will not benefit from MTX treatment and, therefore, assist clinicians in personalizing RA treatment
22180458 Results proved in cultured skin fibroblasts from patients with AICA-ribosiduria that various mutations of ATIC destabilize to various degrees purinosome assembly.
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHP      1 - 70
AVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHA     71 - 140
RVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGM    141 - 210
NPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLS    211 - 280
EDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEA    281 - 350
LTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV    351 - 420
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNA    421 - 490
IDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIA    491 - 560
APSGSAADKVVIEACDELGIILAHTNLRLFHH                                          561 - 592
//

Text Mined References (57)

PMID Year Title
26799664 2016 ATIC 347C>G gene polymorphism may be associated with methotrexate-induced adverse events in south Indian Tamil rheumatoid arthritis.
25823786 2015 Correlation of genetic polymorphisms with clinical outcomes in pemetrexed-treated advanced lung adenocarcinoma patients.
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25425682 2015 Cyclosporine and methotrexate-related pharmacogenomic predictors of acute graft-versus-host disease.
25240429 2015 5-Aminoimidazole-4-carboxamide ribonucleotide-transformylase and inosine-triphosphate-pyrophosphatase genes variants predict remission rate during methotrexate therapy in patients with juvenile idiopathic arthritis.
25084201 2014 Polymorphisms in genes involved in the mechanism of action of methotrexate: are they associated with outcome in rheumatoid arthritis patients?
24967362 2014 Prediction of methotrexate clinical response in Portuguese rheumatoid arthritis patients: implication of MTHFR rs1801133 and ATIC rs4673993 polymorphisms.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...