Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.34
PubTator Score 10.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.518 0.012
posterior fossa group B ependymoma 1.600 0.000
pancreatic ductal adenocarcinoma liver m... -2.959 0.009
psoriasis -1.200 0.000
ovarian cancer -2.000 0.000

Synonym

Accession P31937 Q546Z2 Q9UDN3 HIBADH
Symbols NS5ATP1

Gene

PANTHER Protein Class (2)

PDB

2GF2   2I9P  

Gene RIF (3)

PMID Text
23423614 HIBADH is involved in the mitochondrial function of spermatozoa, and maintains sperm motility. It may serve as a sperm-motility marker.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDV      1 - 70
FPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVS     71 - 140
KELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKI    141 - 210
CNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTT    211 - 280
LMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF                  281 - 336
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23423614 2013 Characterization of 3-hydroxyisobutyrate dehydrogenase, HIBADH, as a sperm-motility marker.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
16466957 2006 Clinical, biochemical, and molecular findings in three patients with 3-hydroxyisobutyric aciduria.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...