Property Summary

NCBI Gene PubMed Count 23
PubMed Score 29.99
PubTator Score 10.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.5e-06
psoriasis 6694 6.8e-06
Multiple myeloma 1332 4.3e-05
osteosarcoma 7950 5.4e-05
pancreatic ductal adenocarcinoma liver metastasis 1962 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.933 4.3e-05
osteosarcoma 1.204 5.4e-05
ovarian cancer 2.400 4.5e-06
pancreatic ductal adenocarcinoma liver m... -1.077 2.4e-02
psoriasis 3.000 6.8e-06

Gene RIF (6)

AA Sequence

MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCT      1 - 70
VGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDL     71 - 140
PKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRK    141 - 210
LSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDD    211 - 280
ALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAE    281 - 350
TGLLGAHFVCDRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY    351 - 420
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF              421 - 480
//

Text Mined References (28)

PMID Year Title