Property Summary

NCBI Gene PubMed Count 100
Grant Count 161
R01 Count 87
Funding $19,176,315.97
PubMed Score 578.52
PubTator Score 372.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis -2.100 0.011
malignant mesothelioma 5.700 0.000
esophageal adenocarcinoma 1.100 0.034
cutaneous lupus erythematosus 2.600 0.001
psoriasis -1.300 0.004
osteosarcoma -3.163 0.001
periodontitis 1.100 0.000
glioblastoma 1.200 0.006
medulloblastoma, large-cell 1.700 0.000
breast carcinoma 1.300 0.029
lung cancer -2.400 0.001
active Crohn's disease -1.792 0.033
pancreatic cancer 1.100 0.003
Multiple Sclerosis 1.400 0.000
interstitial cystitis 2.200 0.003
adult high grade glioma 1.400 0.000
lung carcinoma -3.300 0.000
invasive ductal carcinoma 1.300 0.039

Synonym

Accession P31785 Q5FC12
Symbols P64
CIDX
IMD4
CD132
SCIDX
IL-2RG
SCIDX1

Gene

PDB

1ILM   1ILN   2B5I   2ERJ   3QAZ   4GS7   1ITE   3BPL   1ILL   3QB7  

Gene RIF (61)

PMID Text
26551670 High IL2RG expression is associated with Sezary syndrome.
26468051 Identification of a gammaC splice isoform revealed expression of soluble gammaC proteins (sgammaC). sgammaC directly interacted with surface IL-2Rbeta to suppress IL-2 signaling and to promote pro-inflammatory Th17 cell differentiation. [review]
26409833 Interleukin 2 receptor subunit gamma mutation is associated with X-linked severe combined immunodeficiency.
26407811 novel missense mutation in Japanese patient results in atypical X-linked severe combined immunodeficiency with the presence of T cells and NK cells and revertant somatic mosaicism
26183780 Targeting the binding interface on a shared receptor subunit of a cytokine family enables the inhibition of multiple member cytokines with selectable target spectrum.
26125817 Study show the detection of IL2RG mutations in 2 families with X-SCID and identified 2 novel mutations, confirming the X-SCID pedigrees.
26076747 reversion of mutation in common lymphoid progenitor results in mild phenotype of SCID
25275127 HIV-1 Vpu downregulates the cell surface expression of interleukin 2 receptor, gamma (IL2RG, CD132)
25109334 Results demonstrate that IL2Rgamma has an onogenic role in JAK3-mutation-positive leukemias.
24771849 in humans, signaling through the gammac pathway is not required for prethymic lymphoid commitment or for DNA rearrangement.
More...

AA Sequence

MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM      1 - 70
NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR     71 - 140
QATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSL    141 - 210
PSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVY    211 - 280
FWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP    281 - 350
CNQHSPYWAPPCYTLKPET                                                       351 - 369
//

Text Mined References (102)

PMID Year Title
26551670 2015 Genomic profiling of Sézary syndrome identifies alterations of key T cell signaling and differentiation genes.
26468051 2016 The common ?-chain cytokine receptor: tricks-and-treats for T cells.
26409833 2015 A novel common gamma chain mutation in a Chinese family with X-linked severe combined immunodeficiency (X-SCID; T(-)NK(-)B(+)).
26407811 2015 Late-Onset Combined Immunodeficiency with a Novel IL2RG Mutation and Probable Revertant Somatic Mosaicism.
26183780 2015 Targeting the binding interface on a shared receptor subunit of a cytokine family enables the inhibition of multiple member cytokines with selectable target spectrum.
26125817 2015 Mutation analyses and prenatal diagnosis in families of X-linked severe combined immunodeficiency caused by IL2R? gene novel mutation.
26076747 2015 IL2RG reversion event in a common lymphoid progenitor leads to delayed diagnosis and milder phenotype.
25416956 2014 A proteome-scale map of the human interactome network.
25109334 2015 Functional RNAi screen targeting cytokine and growth factor receptors reveals oncorequisite role for interleukin-2 gamma receptor in JAK3-mutation-positive leukemia.
24771849 2014 Human lymphoid development in the absence of common ?-chain receptor signaling.
More...