Property Summary

Ligand Count 3
NCBI Gene PubMed Count 106
PubMed Score 605.40
PubTator Score 372.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Gamma chain deficiency 7 0.0 5.0
Disease Target Count Z-score Confidence
Lymphopenia 67 3.847 1.9
Cancer 2499 3.684 1.8

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.792 3.3e-02
adult high grade glioma 1.400 3.0e-04
breast carcinoma 1.300 2.9e-02
cutaneous lupus erythematosus 2.600 7.1e-04
esophageal adenocarcinoma 1.100 3.4e-02
glioblastoma 1.200 6.5e-03
interstitial cystitis 2.200 3.0e-03
invasive ductal carcinoma 1.300 3.9e-02
lung cancer -2.400 8.3e-04
lung carcinoma -3.300 3.6e-34
malignant mesothelioma 5.700 9.0e-10
medulloblastoma, large-cell 1.700 4.2e-04
Multiple Sclerosis 1.400 1.4e-05
osteosarcoma -3.163 5.9e-04
pancreatic cancer 1.100 2.5e-03
periodontitis 1.100 1.6e-28
psoriasis -1.300 3.9e-03
Rheumatoid arthritis -2.100 1.1e-02

Protein-protein Interaction (5)

Gene RIF (67)

AA Sequence

MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYM      1 - 70
NCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRR     71 - 140
QATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSL    141 - 210
PSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVY    211 - 280
FWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASP    281 - 350
CNQHSPYWAPPCYTLKPET                                                       351 - 369
//

Text Mined References (108)

PMID Year Title