Property Summary

NCBI Gene PubMed Count 222
Grant Count 306
R01 Count 204
Funding $22,189,496.73
PubMed Score 298.52
PubTator Score 282.24

Knowledge Summary

Patent (36,100)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.100 0.014
osteosarcoma -1.908 0.000
pancreatic ductal adenocarcinoma liver m... -1.064 0.011
subependymal giant cell astrocytoma -1.238 0.038
ovarian cancer -1.200 0.000

Synonym

Accession P31751 B2RBD8 Q05BV0 Q0VAN0 Q0VAN1 Q68GC0
Symbols PKBB
PRKBB
HIHGHH
PKBBETA
RAC-BETA

Gene

PDB

1O6K   1O6L   2JDO   2JDR   2UW9   2X39   2XH5   3E87   3E88   3E8D   1GZK   1GZN   1GZO   1MRV   1MRY   1P6S   3D0E  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (221)

PMID Text
26971877 controls endothelial Jagged1 expression and, thereby, Notch signalling regulating VSMC maintenance.
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26711268 Active, phosphorylated Akt2 translocates to the nucleus in Notch-expressing cells, resulting in GSK-3beta inactivation in this compartment.
26512921 High AKT2 expression is associated with ovarian cancer.
26500117 These studies identify Akt2 as a critical kinase that regulates radixin phosphorylation and leads to Mrp-2 translocation and function.
26475619 High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the beta2-adrenergic receptor
26318486 AKT1 but not AKT2 protects islet cells from apoptosis and drives proliferation.
26270987 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
26270987 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
26265781 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
More...

AA Sequence

MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRP      1 - 70
NTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAV     71 - 140
SKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHP    141 - 210
FLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLEN    211 - 280
LMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPF    281 - 350
YNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK    351 - 420
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE             421 - 481
//

Text Mined References (239)

PMID Year Title
26971877 2016 Stability and function of adult vasculature is sustained by Akt/Jagged1 signalling axis in endothelium.
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26711268 2015 A Switch in Akt Isoforms Is Required for Notch-Induced Snail1 Expression and Protection from Cell Death.
26512921 2015 MicroRNA-29B (mir-29b) regulates the Warburg effect in ovarian cancer by targeting AKT2 and AKT3.
26500117 2016 Akt2-Dependent Phosphorylation of Radixin in Regulation of Mrp-2 Trafficking in WIF-B Cells.
26475619 2016 High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the ?2-adrenergic receptor.
26318486 2015 Specific and redundant roles of PKB?/AKT1 and PKB?/AKT2 in human pancreatic islets.
26265781 2015 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26229955 2015 RLN2 Is a Positive Regulator of AKT-2-Induced Gene Expression Required for Osteosarcoma Cells Invasion and Chemoresistance.
26158514 2015 miR-612 negatively regulates colorectal cancer growth and metastasis by targeting AKT2.
More...