Property Summary

NCBI Gene PubMed Count 222
PubMed Score 298.52
PubTator Score 282.24

Knowledge Summary

Patent (36,100)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.100 1.4e-02
osteosarcoma -1.908 3.7e-05
pancreatic ductal adenocarcinoma liver m... -1.064 1.1e-02
subependymal giant cell astrocytoma -1.238 3.8e-02
ovarian cancer -1.200 2.3e-05

Synonym

Accession P31751 B2RBD8 Q05BV0 Q0VAN0 Q0VAN1 Q68GC0
Symbols PKBB
PRKBB
HIHGHH
PKBBETA
RAC-BETA

Gene

PDB

1O6K   1O6L   2JDO   2JDR   2UW9   2X39   2XH5   3E87   3E88   3E8D   1GZK   1GZN   1GZO   1MRV   1MRY   1P6S   3D0E  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (215)

PMID Text
26971877 controls endothelial Jagged1 expression and, thereby, Notch signalling regulating VSMC maintenance.
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26711268 Active, phosphorylated Akt2 translocates to the nucleus in Notch-expressing cells, resulting in GSK-3beta inactivation in this compartment.
26512921 High AKT2 expression is associated with ovarian cancer.
26500117 These studies identify Akt2 as a critical kinase that regulates radixin phosphorylation and leads to Mrp-2 translocation and function.
26475619 High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the beta2-adrenergic receptor
26318486 AKT1 but not AKT2 protects islet cells from apoptosis and drives proliferation.
26270987 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
26265781 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26229955 the correlation between RLN2 and p-AKT or RLN2 and p-ERK1/2 expression was investigated.
26158514 miR-612 directly suppressed AKT2, which in turn inhibited the downstream epithelial-mesenchymal transition-related signaling pathway.
26102366 miR-137 which is frequently down-regulated in gastric cancer is potentially involved in gastric cancer tumorigenesis and metastasis by regulating AKT2 related signal pathways
25951903 Up-regulation of AKT2 was associated with chemoresistance in renal cell carcinoma.
25936945 QSAR based docking studies identify marine algal callophycin A as inhibitor of protein kinase B beta.
25894377 we assayed expression of myosin II.. this assay is a powerful predictor of the use of ZEB2/Akt2 as a marker for tumor progression in serous ovarian cancers.
25856297 miR-615-5p inhibits pancreatic cancer cell proliferation, migration, and invasion by targeting AKT2
25771729 PIK3CA and AKT2 mutations occurred at low frequency in gastric cancer.
25733895 The results indicate that BCAM-AKT2 expression is a new mechanism of AKT2 kinase activation in high-grade serous ovarian carcinoma.
25428377 findings suggested that AKT2 may be one of the targets of miR29s in gastric cancer
25304263 Our study uncovers a novel molecular mechanism by which AEG-1 augments glioma progression and offers a rationale to block AEG-1-Akt2 signaling function as a novel GBM treatment.
25288334 let-7b/g inhibited AKT2 expression by directly binding to its 3'UTR, reduced p-AKT (S473) activation and suppressed expression of the downstream effector pS6.
25285168 MiR-194 deregulation contributes to colorectal carcinogenesis via reducing the expression AKT2.
25253241 Akt1 and Akt2 are involved in albumin endocytosis, and phosphorylation of Dab2 by Akt induces albumin endocytosis in proximal tubule epithelial cells.
25246356 The individual contribution of each Akt isoform in p120 RasGAP fragment N-mediated cell protection against Fas ligand induced cell death, was investigated.
25233414 Data suggest that three isoforms of the serine/threonine protein kinase Akt (Akt1, Akt2, Akt3) regulate cell survival, cell growth, cell proliferation, and cell metabolism in breast cancer cells. [REVIEW]
25173755 Mutations in genes such as AKT2, CCNA1, MAP3K4, and TGFBR1, were associated significantly with Epstein-Barr-positive gastric tumors, compared with EBV-negative tumors.
25162660 AKT isoform-specific knock down combined with quantitative phosphoproteomics provided a powerful strategy to unravel AKT isoform-specific signaling
25134663 the biological effect of Akt2 in colorectal cancer cells
25104021 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
25059120 Knockdown of Akt2 using siRNAs or the PI3K inhibitor Ly294002 inhibited TGF-beta1-induced phosphorylation of GSK3beta and expression of Snail1
25025572 Role of the guanine nucleotide exchange factor in Akt2-mediated plasma membrane translocation of GLUT4 in insulin-stimulated skeletal muscle.
24970808 Findings indicate that miR-137 is a valuable biomarker for hepatocellular carcinoma (HCC) prognosis and the forkhead box D3 (FoxD3)/miR-137/AKT2 regulatory network plays an important role in HCC progression.
24946858 Findings suggest that adding chloroquine to EGF receptor (EGFR) and AKT2 inhibition has the potential to improve tumor responses in EGFR M+ non-small cell lung cancer (NSCLC).
24838891 The specific role of AKT2 in tumor maintenance provides a rationale for the development of isoform-specific inhibitors for patients with PTEN-deficient cancers.
24819169 SchA-FAK-p85 complex subsequently selectively recruited and activated Akt2, not Akt1
24769357 CK2-dependent phosphorylation is therefore a crucial event which, discriminating between Akt1 and Akt2, can account for different substrate specificities.
24699302 We examined the response of 80 samples of primary cells from acute myeloid leukemia patients to selective inhibitors of the phosphatidylinositol 3 kinase (PI3K)/Akt/mammalian target of rapamycin (mTOR) axis.
24658403 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
24656454 AKT2 may play an important role in the development of meningioma. High AKT2 labeling index indicates higher grade of meningioma, and therefore AKT2 may be a useful molecular marker for predicting the prognosis of meningioma.
24642468 AKT2 inhibition reduced heterotypic aggregation of neutrophils and platelets isolated from sickle cell disease patients, suggesting that AKT2 is important for neutrophil recruitment and neutrophil-platelet interactions.
24623414 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
24565443 AA induces Akt2 activation and invasion in MDA-MB-231 cells. Akt2 activation requires the activity of Src, EGFR, and PIK3, whereas migration and invasion require Akt, PI3K, EGFR and metalloproteinases activity.
24469921 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
24337067 Results show that miR-302b inhibits hepatocellular carcinoma cell proliferation and growth in vitro and in vivo by targeting AKT2.
24321521 in a defined subset of bone and soft tissue tumors, including benign tumors, Akt was frequently overexpressed and activated, and AKT1/2 copy number was increased
24247267 Experimental validation indicate that AKT1, AKT2 and AKT3 proteins may all be novel unfavorable prognostic factors for patients with hepatocellular carcinoma.
24244431 Knockdown of RPS7 resulted in increased expression of P85alpha, P110alpha, and AKT2.
24244375 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
24225433 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
24123662 Akt2 downregulation favors limbal keratinocyte stem cell maintenance as a result of a gain of FOXO functions.
24056770 results disclose a new function of Akt2 and identify a potential therapeutic target for preserving glomerular function in CKD
24039187 AKT2 is closely linked to Type II diabetes and the implications of various types of mutations are discussed
24030155 overexpression of 4EBP1, p70S6K, Akt1 or Akt2 could promote the Coxsackievirus B3-induced apoptosis.
23929892 detected and measured all three AKT isoforms 1, 2 and 3 to enable the study of the multiple and variable roles that these isoforms play in AKT breast tumorigenesis
23900341 Findings suggest an important role of Gli1 as a tumor suppressor in neuroblastoma, and offer a mechanism by which AKT2 regulates the subcellular localization, and in turn, inhibits the tumor-suppressive function of Gli1 in neuroblastoma.
23811558 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23777806 Depletion of both Akt2 and ASAH1 is much more potent than depleting each alone at inhibiting neoplastic cell viability/proliferation and invasion.
23746211 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23742646 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23604117 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23567263 AKT1 and AKT2 have non-redundant roles in the regulation of prostate cancer cell proliferation and migration.
23468863 Akt2 regulates metastatic potential in neuroblastoma.
23464484 In a manner that depended on the level of phosphorylated AKT1/2 protein.
23444369 Insulin signaling via Akt2 switches plakophilin 1 function from stabilizing cell adhesion to promoting cell proliferation.
23321478 Data suggest that although COOH-terminal dephosphorylation is likely necessary for glycogen synthase (GS) activation, Akt2-dependent NH2-terminal dephosphorylation is the site for "fine-tuning" insulin-mediated GS activation in skeletal muscle.
23305873 Data indicate that the prognostic value of Akt2 increases with higher oestrogen receptor (ER) expression, motivating further mechanistic studies on the role of Akt2 in ER+ breast cancer.
23301033 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23251686 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23250987 In cultured human aortic vascular smooth muscle cells, AKT2 inhibited the expression of MMP-9 and stimulated the expression of TIMP-1 by preventing the binding of transcription factor forkhead box protein O1 to the MMP-9 and TIMP-1 promoters.
23092922 CD40L-provoked signaling results in the production of several cytokines. Among these, IL-6 expression is mediated through Akt and NF-kappaB pathways.
23077641 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
23018889 An Akt2/PKBbeta-targeted siRNA inhibited the 8-Cl-cAMP- and AICAR-mediated phosphorylation of AMPK and p38 MAPK.
22904195 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
22809628 these data define an inhibitory role for both AKT1 and AKT2 in prostate cancer migration and invasion and highlight the cell type-specific actions of AKT kinases in the regulation of cell motility.
22778840 In transfected HEK2 cells, basal activity of Akt2 regulates DAT cell surface expression.
22748472 amplification of AKT1 and/or AKT2 and high-level polysomy were found in 16% of total lung carcinoma cases, and this defined subset was characterized by the overexpression/activation of Akt, reciprocal to EGFR aberrations.
22556379 Although there is an association of PI3 kinase signaling and chemoresistance in advanced ovarian cancer, there is no clear evidence that this is driven specifically by AKT2 mutations.
22480544 study concludes that Akt2 is indispensable for the regulation of preadipocyte and adipocyte number, whereas Akt1 and Akt2 are equally important for the regulation of insulin-stimulated metabolic pathways in adipocytes
22261254 Akt2 is a negative regulator of NFAT activation through its ability to inhibit calcium mobilization from the endoplasmic reticulum.
22158034 Unexpected roles of Akt2 in transcriptional control and phosphorylation of Thr45 in histone H3 as a new epigenetic mark related to Snail1 and Akt2 action.
22107784 The prognostic impact of Akt (Akt1) phosphorylated at threonine308 and serine473, Akt2, Akt3, PI3K and PTEN, alone and in coexpression with ER and PgR in non-gastrointestinal stromal tumor soft tissue sarcomas.
22031698 analysis of resistance of Akt kinase and PP2A to dephosphorylation through ATP-dependent conformational plasticity
21979951 Akt2 kinase suppresses glyceraldehyde-3-phosphate dehydrogenase (GAPDH)-mediated apoptosis in ovarian cancer cells via phosphorylating GAPDH at threonine 237 and decreasing its nuclear translocation
21979934 3 unrelated children with unexplained, recurrent and severe fasting hypoglycemia and asymmetrical growth were found to carry the same de novo mutation, p.Glu17Lys, in AKT2, in 2 cases as heterozygotes and in 1 case in mosaic form
21932427 This study revealed a novel mechanism of Akt2 regulation by ErbB2 in prostate cancer cells.
21765914 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
21763505 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
21722267 AKT1 and AKT2 both contribute to cell survival, albeit via different mechanisms; the effects on cell growth and migration are predominantly regulated by AKT1
21697490 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
21680733 Angiopoietin-2, an angiogenic regulator, promotes initial growth and survival of breast cancer metastases to the lung through the integrin-linked kinase (ILK)-AKT1,2-B cell lymphoma 2 (Bcl-2) pathway.
21636708 High AKT2 is associated with glioma progression.
21618512 Data suggest a regulation pathway of B-cell-lymphoma-2 (Bcl-2) by cisplatin, via the activation of PKC and Akt2, which has impact on resistance to cisplatin-induced apoptosis in endometrial cancer cells.
21606541 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
21590431 Transcriptional activation of the Akt2 pathway indicates that it is involved in lumbar disc degeneration.
21518566 The Akt2 gene is not a major cause of diabetes in a non-obese Chinese Han population characterized by insulin resistance.
21507933 loss of Akt1 or Akt2 decreased proliferation of Pten wild-type astrocytes, whereas combined loss of multiple isoforms was needed to inhibit proliferation of Pten-null astrocytes
21483469 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
21432781 analysis of the roles of Akt1 and Akt2 in cancer [review]
21423810 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
21297943 Akt2 augments cell proliferation by facilitating cell cycle progression through the upregulation of the cell cycle engine, and protects a cell from pathological autophagy by modulating mitochondrial homeostasis.
21182834 Data suggest that Akt2/B23 functions as an oncogenic unit to drive tumorigenesis of A549 lung cancer cells.
21179235 Advanced glycation end products of BSA can induce endothelial-to-mesenchymal transition of cultured human and monkey endothelial cells and AKT2 may play a role in this process.
21092549 Expressions of Akt1, Akt2 and PI3K were decreased in ovarian epithelial cancer cells transduced with PTEN.
21050850 Akt signaling regulates the stability of palladin
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21029719 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
20848774 The positive expression of p-AKT2 in lung adenocarcinoma was higher than that in lung squamous carcinomas.
20818790 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
20691427 Observational study of gene-disease association. (HuGE Navigator)
20688159 The expression levels and activities of exogenous Akt1 and Akt2 are almost identical, Akt2 exerted a greater inhibitory effect on both proliferation and cell migration.
20687898 SGK3 is not required for insulin-induced PFK-2 activation and that this effect is likely mediated by PKBalpha.
20661303 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20514445 AKT2 expression is associated with more advanced and especially aggressive gliomas and critical for cell survival and invasion.
20447721 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20409325 MYCN contributes to tumorigenesis, in part, by repressing miR-184, leading to increased levels of AKT2, a direct target of miR-184
20398329 Studies indicate that three different isoforms Akt1, Akt2, and Akt3 have distinct expression patterns and functions.
20354455 AKT2 mutation coexisted with EGFR and PIK3CA mutations was associated with lung cancer.
20354455 Observational study of gene-disease association. (HuGE Navigator)
20186503 We evaluated the presence of mutations in PIK3CA, AKT1, AKT2, AKT3, PTEN, and PDPK1 genes in 83 papillary thyroid carcinomas
20186503 Observational study of gene-disease association. (HuGE Navigator)
20167810 Our data suggest that Akt2 and Akt3 play an important role in the viability of human malignant glioma cells.
20133737 Data show that AKT1 and AKT2 appeared to regulate growth through FOXO proteins, but not through either GSK3beta or mTOR, and in contrast, inactivation of PDPK1 affected GSK3beta and mTOR activation.
20116920 Akt2 may play a critical role in the development of gliomas and present a potential therapeutic target for malignant gliomas
20109457 Results represent the first indication that Akt isoforms regulate intermediate filament protein expression and support the hypothesis that IFs are involved in PI3K/Akt pathway.
20102399 In breast cancer AKT3 amplifications and AKT1 and AKT2 deletions were seen by FISH
20059950 By using yeast two-hybrid systems with full-length human Akt2 as bait, we found a stable interaction between the tetratricopeptide (TPR) repeat domain 3 (TTC3) and Akt; finding could underlie important clinical manifestations of Down syndrome.
20056908 Plasmin triggers chemotaxis of monocyte-derived dendritic cells through an Akt2-dependent pathway and promotes a T-helper type-1 response.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20041213 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
20019835 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
20018949 Akt2 was located in the mitochondria of human cell lines.
20012528 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
19933843 These findings provide further evidence of the importance of mediators of the growth factor signaling in ER regulation, introducing the Akt2/FoxO3a axis as a pursuable target in therapy for ER-positive breast cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19843246 Taken together, these results showed that, in addition to the MAPK pathway previously reported being a downstream target of stimulated Grm1, AKT2 is another downstream target in Grm1 mediated melanocyte transformation.
19825827 induction of EMT is controlled by microRNAs whose abundance depends on the balance between Akt1 and Akt2 rather than on the overall activity of Akt
19797172 mTOR/Akt2 is required for optimal PPARgamma activation. Patients who receive SESs during concomitant RSG treatment may be at risk for delayed stent healing.
19771908 The positive rate of AKT2 protein expression in laryngeal squamous cell carcinoma was significantly higher than that in peri-cancer tissue and normal laryngeal epithelium, and was correlated with tumor site, lymph node metastasis and clinical stage.
19479051 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
19453261 Observational study of gene-disease association. (HuGE Navigator)
19435822 Findings indicate that AP-1 has an important function in pancreatic cancer cells and provide evidence for a previously unknown Akt-mediated mechanism of c-Jun activation.
19261608 Bcr-Abl represses the expression of PHLPP1 and PHLPP2 and continuously activates Akt1, -2, and -3 via phosphorylation on Ser-473, resulting in the proliferation of CML cells
19197940 Akt2 plays an essential role in both CSF-1- and chemokine-induced chemotaxis of macrophages.
19164214 genetic variations in akt2 were associated with survival in esophageal cancer
19164214 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19110052 Akt2 up-regulates beta1 integrins & promotes adhesion & invasion of breast cancer cells in vitro & also metastasis in vivo. It opposes Akt1. Review.
19079138 mtDNA depletion prevents detachment-induced apoptosis (anoikis) and promotes migratory capabilities onto basement membrane proteins through upregulation of p85 and p110 phosphatidylinositol 3-kinase (PI3K) subunits, which results in Akt2 activation
19075230 the consequence of PTEN loss and Akt2 overexpression function synergistically to promote metastasis
19074768 an important role of PKC-delta and PI3K/Akt1,2 pathways in activating mTOR as an endogenous modulator to ensure a tight regulation of NF-kappaB signaling of ICAM-1 expression in endothelial cells.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18842333 Akt2 down-regulation sensitizes ovarian cancer cells to paclitaxel-induced apoptosis, and inhibits survivin expression
18826950 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
18768676 Polymorphisms in two components of the insulin signaling pathway, AKT2 and GSK3B, are associated with polycystic ovary syndrome.
18768676 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18353613 Results suggest that Akt2 directly mediates EGF-induced chemotactic signaling pathways through PKCzeta and its expression is critical during the extravasation of circulating cancer cells.
18316591 Dlx5 can act as an oncogene by cooperating with Akt2 to promote lymphomagenesis
18300076 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
18281467 Functional convergence of Twist and AKT2 underscores the importance of this signaling pathway in tumor development and progression.
18187620 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
18048359 a key regulatory role of the Akt/mTOR pathway in the generation of the effects of As(2)O(3)
17914025 Akt1 and Akt2 mediate GPIb-IX signaling via the cGMP-dependent signaling pathway.
17908691 Akt2 is required for rapamycin-induced vascular smooth muscle cell differentiation, whereas Akt1 appears to oppose contractile protein expression.
17895832 PKB[alpha] and/or PKB[gamma] and not PKB[beta] alone are involved in gemcitabine resistance mechanisms.
17825284 Pressure did not stimulate translocation of AKT2 to the plasma membrane.
17804734 AKT2 up-regulation is characteristic of skin squamous cell carcinoma and coincident AKT2 activation through serine phosphorylation correlates with malignancy.
17576055 Two variants in 5' regulatory region of Akt2 gene are associated and may modulate susceptibility to insulin resistance and related metabolic abnormalities.
17576055 Observational study of gene-disease association. (HuGE Navigator)
17482291 the PI3K/AKT/mTOR signaling pathway is involved in regulation of SphK1, with AKT2 playing a key role in PDGF-induced SphK1 expression
17372934 Changes in tissue pressure during inflammation may regulate macrophage phagocytosis by activation of PI-3K, which activates Akt2, mTOR, and p70S6K.
17349711 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
17332325 Twist as a positive transcriptional regulator of AKT2 expression; Twist-AKT2 signaling is involved in promoting invasive ability and survival of breast cancer cells.
17327441 Observational study of gene-disease association. (HuGE Navigator)
17327441 Sequencing of the entire coding region and splice junctions of AKT2 and the relationship of genetic variations in the gene with multiple metabolic diseases is reported.
17276404 Akt1 induces CREB phosphorylation at Ser-133 and CREB target gene expression.
17157319 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
17012749 Akt1 and Akt2 have opposing roles in Rac/Pak signaling and cell migration
16982699 These data show that specific interaction of the Akt2 isoform with p21 is key to its negative effect on normal cell cycle progression.
16841089 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
16524887 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
16402276 results suggest that AKT pathway may play an important role in the development and progression of gliomas
16365168 In this study, we provide evidence for isoform-specific positive and negative roles for Akt1 and -2 in regulating growth factor-stimulated phenotypes in breast epithelial cells
15987444 in breast cancer patients, Akt activation is associated with tumour proliferation and poor prognosis, particularly in the subset of patients with ErbB2-overexpressing tumours
15890450 Kinetic analysis of GST-AKT2 demonstrates that phosphorylation of Thr309 in the activation loop of the kinase is largely responsible for observed reduction in Km & for a subsequent 150-fold increase in the catalytic efficiency (k(cat)/Km) of the enzyme.
15689238 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
15616007 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
15557754 AKT2 plays an important role in glioma cell motility and invasion
15531580 Akt2 is a critical kinase that regulates ezrin phosphorylation and activation
15166380 a mutation in AKT2 in a family showing autosomal dominant inheritance of severe insulin resistance and diabetes mellitus is described; the mutant kinase in cultured cells disrupted insulin signaling and inhibited the function of coexpressed, wild-type AKT
15111130 These results suggest that cross-talk between the PKB and caspase-8 pathways may regulate the balance between cell survival and cell death in ECV304.
15102693 activated Akt and Akt2 have roles in progression of pancreatic ductal adenocarcinoma
15010337 Thus a physiological concentration of insulin stimulated Akt-1 & Akt-2 phosphorylation in human skeletal muscle in the absence of hyperglycemia, but Akt-2 expression is impaired in muscle of obese patients with atypical diabetes with severe hyperglycemia.
14735903 data suggest that upstream perturbations of the PI3K/AKT pathway contribute to frequent activation of AKT2 in pancreatic cancer, which may contribute to the pathogenesis of this highly aggressive form of human malignancy
14699494 Lipid rafts(LR) may play important role in determining function of PI 3-K/Akt2 signaling, including stimulation of intestinal Na absorption. LR-associated Akt2 may be involved in enterocyte differentiation.
14654898 Findings suggest that Akt2 is a novel independent predictor for the development and progression of hepatocellular carcinoma .
14637151 Our data suggest that Akt is an endogenous inhibitor during TRAIL-mediated synovial cell apoptotic pathway.
14612499 Akt2 may be an important regulator of both Xiap and p53 contents in ovarian cancer after CDDP challenge.
14504284 Akt2 phosphorylates MLK3, which results in the disassembly of the JNK complex bound to POSH and down-regulation of the JNK signaling pathway
12808085 Akt regulates basic helix-loop-helix transcription factor-coactivator complex formation and activity during neuronal differentiation
12733712 both p70S6K and Akt are activated in the majority of human papillary cancer cells.
12663464 results show that a defect in the ability of insulin to activate Akt-2 and -3 may explain the impaired insulin-stimulated glucose transport in insulin resistance
12545160 These results indicate that PI3k/Akt pathway is involved in the signaling cascade of glioma cells required to induce cell migration.
12517798 data indicate that AKT2 mediates PI3-K-dependent effects on adhesion, motility, invasion, and metastasis in vivo
12517337 Results describe the structure of an inactive and unliganded Akt2 kinase domain, and several features that distinguish it from other kinases.
12482965 a new mechanism for androgen-mediated prostate cancer cell survival and establish FKHR as nuclear target for both AKT-dependent and -independent survival signals in prostate cancer cells.
12480711 Activation of AKT consequent to binding of albumin by CLL cells blocks chlorambucil- and radiation-induced apoptosis.
12114503 In renal tubular epithelial cell, Akt phosphorylation is up-regulated in an effort to minimize cell death.
11994280 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
11208609 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
11156964 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
10869418 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes
9394803 HIV-1 Vpr-induced upregulation of CCL5 requires p50 and p65 subunits of NFKB1 (NF-kappa-B), p38delta MAPK, Akt-2 and Akt-3, and AP-1 transcription factor in HIV-1 Vpr transfected astrocytes

AA Sequence

MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRP      1 - 70
NTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAV     71 - 140
SKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHP    141 - 210
FLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLEN    211 - 280
LMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPF    281 - 350
YNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK    351 - 420
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE             421 - 481
//

Text Mined References (239)

PMID Year Title
26971877 2016 Stability and function of adult vasculature is sustained by Akt/Jagged1 signalling axis in endothelium.
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26711268 2015 A Switch in Akt Isoforms Is Required for Notch-Induced Snail1 Expression and Protection from Cell Death.
26512921 2015 MicroRNA-29B (mir-29b) regulates the Warburg effect in ovarian cancer by targeting AKT2 and AKT3.
26500117 2016 Akt2-Dependent Phosphorylation of Radixin in Regulation of Mrp-2 Trafficking in WIF-B Cells.
26475619 2016 High constitutive Akt2 activity in U937 promonocytes: effective reduction of Akt2 phosphorylation by the histamine H2-receptor and the ?2-adrenergic receptor.
26318486 2015 Specific and redundant roles of PKB?/AKT1 and PKB?/AKT2 in human pancreatic islets.
26265781 2015 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26229955 2015 RLN2 Is a Positive Regulator of AKT-2-Induced Gene Expression Required for Osteosarcoma Cells Invasion and Chemoresistance.
26158514 2015 miR-612 negatively regulates colorectal cancer growth and metastasis by targeting AKT2.
26102366 2015 MicroRNA-137 Contributes to Dampened Tumorigenesis in Human Gastric Cancer by Targeting AKT2.
25951903 2015 let-7b and let-7c are determinants of intrinsic chemoresistance in renal cell carcinoma.
25936945 2015 QSAR based docking studies of marine algal anticancer compounds as inhibitors of protein kinase B (PKB?).
25894377 2015 Akt2/ZEB2 may be a biomarker for exfoliant cells in ascitic fluid in advanced grades of serous ovarian carcinoma.
25856297 2015 MiRNA-615-5p functions as a tumor suppressor in pancreatic ductal adenocarcinoma by targeting AKT2.
25771729 2014 Occurrence of low frequency PIK3CA and AKT2 mutations in gastric cancer.
25733895 2015 Recurrent BCAM-AKT2 fusion gene leads to a constitutively activated AKT2 fusion kinase in high-grade serous ovarian carcinoma.
25428377 2015 MicroRNA-29s could target AKT2 to inhibit gastric cancer cells invasion ability.
25304263 2014 Astrocyte elevated gene-1 interacts with Akt isoform 2 to control glioma growth, survival, and pathogenesis.
25288334 2014 let-7b/g silencing activates AKT signaling to promote gastric carcinogenesis.
25285168 2014 MiR-194 deregulation contributes to colorectal carcinogenesis via targeting AKT2 pathway.
25253241 2014 Akt recruits Dab2 to albumin endocytosis in the proximal tubule.
25246356 2014 The activity of the anti-apoptotic fragment generated by the caspase-3/p120 RasGAP stress-sensing module displays strict Akt isoform specificity.
25233414 2014 Signalling specificity in the Akt pathway in breast cancer.
25173755 2014 Integrative identification of Epstein-Barr virus-associated mutations and epigenetic alterations in gastric cancer.
25162660 2014 AKT1 and AKT2 induce distinct phosphorylation patterns in HL-1 cardiac myocytes.
25134663 2015 Knockdown of Akt2 expression by shRNA inhibits proliferation, enhances apoptosis, and increases chemosensitivity to paclitaxel in human colorectal cancer cells.
25059120 2014 Akt2 mediates TGF-?1-induced epithelial to mesenchymal transition by deactivating GSK3?/snail signaling pathway in renal tubular epithelial cells.
25025572 2014 Role of the guanine nucleotide exchange factor in Akt2-mediated plasma membrane translocation of GLUT4 in insulin-stimulated skeletal muscle.
24970808 2014 FoxD3-regulated microRNA-137 suppresses tumour growth and metastasis in human hepatocellular carcinoma by targeting AKT2.
24946858 2014 Combining AKT inhibition with chloroquine and gefitinib prevents compensatory autophagy and induces cell death in EGFR mutated NSCLC cells.
24838891 2014 PTEN-deficient tumors depend on AKT2 for maintenance and survival.
24819169 2014 SchA-p85-FAK complex dictates isoform-specific activation of Akt2 and subsequent PCBP1-mediated post-transcriptional regulation of TGF?-mediated epithelial to mesenchymal transition in human lung cancer cell line A549.
24769357 2014 Differential phosphorylation of Akt1 and Akt2 by protein kinase CK2 may account for isoform specific functions.
24699302 2014 Feedbacks and adaptive capabilities of the PI3K/Akt/mTOR axis in acute myeloid leukemia revealed by pathway selective inhibition and phosphoproteome analysis.
24656454 2014 AKT2 expression in histopathologic grading and recurrence of meningiomas.
24642468 2014 Neutrophil AKT2 regulates heterotypic cell-cell interactions during vascular inflammation.
24565443 2014 Arachidonic acid promotes migration and invasion through a PI3K/Akt-dependent pathway in MDA-MB-231 breast cancer cells.
24337067 2014 miRNA-302b suppresses human hepatocellular carcinoma by targeting AKT2.
24321521 2014 Significance of Akt activation and AKT gene increases in soft tissue tumors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247267 2014 Identification of AKT kinases as unfavorable prognostic factors for hepatocellular carcinoma by a combination of expression profile, interaction network analysis and clinical validation.
24244431 2013 Small ribosomal protein subunit S7 suppresses ovarian tumorigenesis through regulation of the PI3K/AKT and MAPK pathways.
24123662 2014 Nuclear Akt2 opposes limbal keratinocyte stem cell self-renewal by repressing a FOXO-mTORC1 signaling pathway.
24056770 2013 AKT2 is essential to maintain podocyte viability and function during chronic kidney disease.
24039187 2013 The AKT genes and their roles in various disorders.
24030155 2013 Overexpression of 4EBP1, p70S6K, Akt1 or Akt2 differentially promotes Coxsackievirus B3-induced apoptosis in HeLa cells.
23929892 2013 Identification and quantification of AKT isoforms and phosphoforms in breast cancer using a novel nanofluidic immunoassay.
23900341 2013 Gli1 transcriptional activity is negatively regulated by AKT2 in neuroblastoma.
23823123 2013 Systematic Analysis Reveals Elongation Factor 2 and ?-Enolase as Novel Interaction Partners of AKT2.
23777806 2013 Akt2 and acid ceramidase cooperate to induce cell invasion and resistance to apoptosis.
23567263 2013 Distinct and specific roles of AKT1 and AKT2 in androgen-sensitive and androgen-independent prostate cancer cells.
23468863 2013 Akt2 regulates metastatic potential in neuroblastoma.
23464484 2012 Iris Nertschinskia ethanol extract differentially induces cytotoxicity in human breast cancer cells depending on AKT1/2 activity.
23444369 2013 Insulin signaling via Akt2 switches plakophilin 1 function from stabilizing cell adhesion to promoting cell proliferation.
23321478 2013 Akt2 influences glycogen synthase activity in human skeletal muscle through regulation of NH?-terminal (sites 2 + 2a) phosphorylation.
23305873 2013 Akt2 expression is associated with good long-term prognosis in oestrogen receptor positive breast cancer.
23250987 2013 AKT2 confers protection against aortic aneurysms and dissections.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23092922 2012 Interleukin-6 production in CD40-engaged fibrocytes in thyroid-associated ophthalmopathy: involvement of Akt and NF-?B.
23018889 2013 Involvement of Akt2/protein kinase B ? (PKB?) in the 8-Cl-cAMP-induced cancer cell growth inhibition.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22809628 2012 Distinct roles of AKT isoforms in regulating ?1-integrin activity, migration, and invasion in prostate cancer.
22778840 2010 Akt-dependent and isoform-specific regulation of dopamine transporter cell surface expression.
22748472 2012 Molecular alterations in AKT and its protein activation in human lung carcinomas.
22556379 2012 The association of PI3 kinase signaling and chemoresistance in advanced ovarian cancer.
22480544 2012 Differential function of Akt1 and Akt2 in human adipocytes.
22261254 2012 Akt2 inhibits the activation of NFAT in lymphocytes by modulating calcium release from intracellular stores.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22158034 2012 Akt2 interacts with Snail1 in the E-cadherin promoter.
22107784 2011 The prognostic impact of Akt isoforms, PI3K and PTEN related to female steroid hormone receptors in soft tissue sarcomas.
22031698 2011 Resistance of Akt kinases to dephosphorylation through ATP-dependent conformational plasticity.
21979951 2011 Akt2 kinase suppresses glyceraldehyde-3-phosphate dehydrogenase (GAPDH)-mediated apoptosis in ovarian cancer cells via phosphorylating GAPDH at threonine 237 and decreasing its nuclear translocation.
21979934 2011 An activating mutation of AKT2 and human hypoglycemia.
21932427 2012 ErbB2/Her-2 regulates the expression of Akt2 in prostate cancer cells.
21737686 2011 Ankrd2/ARPP is a novel Akt2 specific substrate and regulates myogenic differentiation upon cellular exposure to H(2)O(2).
21722267 2011 Roles of AKT1 and AKT2 in non-small cell lung cancer cell survival, growth, and migration.
21680733 2011 Angiopoietin-2, an angiogenic regulator, promotes initial growth and survival of breast cancer metastases to the lung through the integrin-linked kinase (ILK)-AKT-B cell lymphoma 2 (Bcl-2) pathway.
21636708 2011 High ?-catenin/Tcf-4 activity confers glioma progression via direct regulation of AKT2 gene expression.
21620960 2011 Akt signalling in health and disease.
21618512 2012 Cisplatin increases B-cell-lymphoma-2 expression via activation of protein kinase C and Akt2 in endometrial cancer cells.
21590431 2011 Akt/PKB isoforms expression in the human lumbar herniated disc: correlation with clinical and MRI findings.
21518566 2011 Contribution of the Akt2 gene to type 2 diabetes in the Chinese Han population.
21507933 2011 Nonredundant functions for Akt isoforms in astrocyte growth and gliomagenesis in an orthotopic transplantation model.
21432781 2011 Akt1 and Akt2: differentiating the aktion.
21297943 2011 Ablation of Akt2 induces autophagy through cell cycle arrest, the downregulation of p70S6K, and the deregulation of mitochondria in MDA-MB231 cells.
21269460 2011 Initial characterization of the human central proteome.
21182834 2011 Akt2 and nucleophosmin/B23 function as an oncogenic unit in human lung cancer cells.
21179235 2010 Advanced glycation end products of bovine serum albumin-induced endothelial-to-mesenchymal transition in cultured human and monkey endothelial cells via protein kinase B signaling cascades.
21092549 2010 [Effects of PTEN over-expression on phosphatidyl inositol 3-kinase/protein kinase B signal pathway in ovarian epithelial cancer cells].
21050850 2010 Akt2 regulates expression of the actin-bundling protein palladin.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20856200 2011 Vimentin is a novel AKT1 target mediating motility and invasion.
20848774 2010 [The expression and clinical significance of AKT2, phosphorylated AKT2 in non-small cell lung cancer].
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20688159 2011 Akt isoform-specific inhibition of MDA-MB-231 cell proliferation.
20687898 2010 Heart 6-phosphofructo-2-kinase activation by insulin requires PKB (protein kinase B), but not SGK3 (serum- and glucocorticoid-induced protein kinase 3).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20514445 2010 AKT2 expression is associated with glioma malignant progression and required for cell survival and invasion.
20447721 2011 PI3K/PTEN/AKT/mTOR pathway genetic variation predicts toxicity and distant progression in lung cancer patients receiving platinum-based chemotherapy.
20409325 2010 MicroRNA-184 inhibits neuroblastoma cell survival through targeting the serine/threonine kinase AKT2.
20398329 2010 Key signalling nodes in mammary gland development and cancer. Signalling downstream of PI3 kinase in mammary epithelium: a play in 3 Akts.
20354455 2010 MEK1 and AKT2 mutations in Japanese lung cancer.
20186503 2010 Mutational and immunohistochemical study of the PI3K/Akt pathway in papillary thyroid carcinoma in Greece.
20167810 2010 Akt2 and Akt3 play a pivotal role in malignant gliomas.
20133737 2010 Genetic inactivation of AKT1, AKT2, and PDPK1 in human colorectal cancer cells clarifies their roles in tumor growth regulation.
20116920 2010 Increased expression of Akt2 and activity of PI3K and cell proliferation with the ascending of tumor grade of human gliomas.
20109457 2010 Akt isoforms regulate intermediate filament protein levels in epithelial carcinoma cells.
20102399 2010 Molecular alterations in AKT1, AKT2 and AKT3 detected in breast and prostatic cancer by FISH.
20059950 2009 The E3 ligase TTC3 facilitates ubiquitination and degradation of phosphorylated Akt.
20056908 2010 Plasmin triggers chemotaxis of monocyte-derived dendritic cells through an Akt2-dependent pathway and promotes a T-helper type-1 response.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20018949 2010 The Akt isoforms are present at distinct subcellular locations.
19933843 2010 Akt2 inhibition enables the forkhead transcription factor FoxO3a to have a repressive role in estrogen receptor alpha transcriptional activity in breast cancer cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19843246 2010 AKT2 is a downstream target of metabotropic glutamate receptor 1 (Grm1).
19825827 2009 MicroRNAs differentially regulated by Akt isoforms control EMT and stem cell renewal in cancer cells.
19797172 2009 Differential healing after sirolimus, paclitaxel, and bare metal stent placement in combination with peroxisome proliferator-activator receptor gamma agonists: requirement for mTOR/Akt2 in PPARgamma activation.
19771908 2009 [The expression of oncogene AKT2 in laryngeal squamous cell carcinoma and its clinical significance].
19713527 2009 The E3 ligase TRAF6 regulates Akt ubiquitination and activation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19435822 2009 Activator protein-1 has an essential role in pancreatic cancer cells and is regulated by a novel Akt-mediated mechanism.
19261608 2009 Depletion of Pleckstrin homology domain leucine-rich repeat protein phosphatases 1 and 2 by Bcr-Abl promotes chronic myelogenous leukemia cell proliferation through continuous phosphorylation of Akt isoforms.
19197940 2009 Akt2 is required for macrophage chemotaxis.
19179070 2009 Aminofurazans as potent inhibitors of AKT kinase.
19164855 2009 Postreceptor insulin resistance contributes to human dyslipidemia and hepatic steatosis.
19164214 2009 Genetic variations in the PI3K/PTEN/AKT/mTOR pathway are associated with clinical outcomes in esophageal cancer patients treated with chemoradiotherapy.
19139280 2009 ClipR-59 interacts with Akt and regulates Akt cellular compartmentalization.
19110052 2009 Function of Akt/PKB signaling to cell motility, invasion and the tumor stroma in cancer.
19079138 2009 Mitochondrial DNA depletion in prostate epithelial cells promotes anoikis resistance and invasion through activation of PI3K/Akt2.
19075230 2008 Akt2 overexpression plays a critical role in the establishment of colorectal cancer metastasis.
19074768 2009 Protein kinase C-delta and phosphatidylinositol 3-kinase/Akt activate mammalian target of rapamycin to modulate NF-kappaB activation and intercellular adhesion molecule-1 (ICAM-1) expression in endothelial cells.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18842333 2009 Implication of the Akt2/survivin pathway as a critical target in paclitaxel treatment in human ovarian cancer cells.
18800763 2008 Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase.
18768676 2008 First evidence of genetic association between AKT2 and polycystic ovary syndrome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18353613 2008 Reduction of Akt2 expression inhibits chemotaxis signal transduction in human breast cancer cells.
18316591 2008 A novel recurrent chromosomal inversion implicates the homeobox gene Dlx5 in T-cell lymphomas from Lck-Akt2 transgenic mice.
18281467 2008 Regulation of cancer cell survival, migration, and invasion by Twist: AKT2 comes to interplay.
18048359 2008 Regulatory effects of mammalian target of rapamycin-mediated signals in the generation of arsenic trioxide responses.
17914025 2008 The role of Akt in the signaling pathway of the glycoprotein Ib-IX induced platelet activation.
17908691 2007 Rapamycin promotes vascular smooth muscle cell differentiation through insulin receptor substrate-1/phosphatidylinositol 3-kinase/Akt2 feedback signaling.
17895832 2007 Dissociation of gemcitabine sensitivity and protein kinase B signaling in pancreatic ductal adenocarcinoma models.
17825284 2008 Identification of functional domains in AKT responsible for distinct roles of AKT isoforms in pressure-stimulated cancer cell adhesion.
17804734 2007 Cutaneous human papillomaviruses down-regulate AKT1, whereas AKT2 up-regulation and activation associates with tumors.
17577629 2007 Akt/PKB interacts with the histone H3 methyltransferase SETDB1 and coordinates to silence gene expression.
17576055 2008 Akt2 Gene common allelic variants in insulin resistance and the metabolic syndrome.
17565718 2008 Akt2 is implicated in skeletal muscle differentiation and specifically binds Prohibitin2/REA.
17535800 2007 Regulation of the Pro-apoptotic scaffolding protein POSH by Akt.
17482291 2007 Sphingosine kinase 1 expression is regulated by signaling through PI3K, AKT2, and mTOR in human coronary artery smooth muscle cells.
17372934 2007 Akt2, but not Akt1 or Akt3 mediates pressure-stimulated serum-opsonized latex bead phagocytosis through activating mTOR and p70 S6 kinase.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17332325 2007 Twist transcriptionally up-regulates AKT2 in breast cancer cells leading to increased migration, invasion, and resistance to paclitaxel.
17327441 2007 Analysis of genetic variation in Akt2/PKB-beta in severe insulin resistance, lipodystrophy, type 2 diabetes, and related metabolic phenotypes.
17276404 2007 Differential activation of CREB by Akt1 and Akt2.
17275837 2007 A structural comparison of inhibitor binding to PKB, PKA and PKA-PKB chimera.
17030088 2007 APPL1, APPL2, Akt2 and FOXO1a interact with FSHR in a potential signaling complex.
17012749 2006 Opposing roles for Akt1 and Akt2 in Rac/Pak signaling and cell migration.
16982699 2006 Only Akt1 is required for proliferation, while Akt2 promotes cell cycle exit through p21 binding.
16814735 2006 siRNA-based gene silencing reveals specialized roles of IRS-1/Akt2 and IRS-2/Akt1 in glucose and lipid metabolism in human skeletal muscle.
16792529 2006 A WD-FYVE protein binds to the kinases Akt and PKCzeta/lambda.
16540465 2006 Kinetic mechanism of AKT/PKB enzyme family.
16417406 2006 Hem-1 complexes are essential for Rac activation, actin polymerization, and myosin regulation during neutrophil chemotaxis.
16402276 2006 The effects of antisense AKT2 RNA on the inhibition of malignant glioma cell growth in vitro and in vivo.
16365168 2005 Distinct roles of Akt1 and Akt2 in regulating cell migration and epithelial-mesenchymal transition.
15987444 2005 Increased level of phosphorylated akt measured by chemiluminescence-linked immunosorbent assay is a predictor of poor prognosis in primary breast cancer overexpressing ErbB-2.
15890450 2005 Activation of a GST-tagged AKT2/PKBbeta.
15557754 Antisense and dominant-negative AKT2 cDNA inhibits glioma cell invasion.
15531580 2005 Akt2 phosphorylates ezrin to trigger NHE3 translocation and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314020 2004 Upstream and downstream of mTOR.
15166380 2004 A family with severe insulin resistance and diabetes due to a mutation in AKT2.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15111130 2004 Protein kinase B inhibits apoptosis induced by actinomycin D in ECV304 cells through phosphorylation of caspase 8.
15102693 2004 Prognostic significance of activated Akt expression in pancreatic ductal adenocarcinoma.
15070827 2004 Human follicle-stimulating hormone (FSH) receptor interacts with the adaptor protein APPL1 in HEK 293 cells: potential involvement of the PI3K pathway in FSH signaling.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15010337 2004 Impaired expression and insulin-stimulated phosphorylation of Akt-2 in muscle of obese patients with atypical diabetes.
14973226 2004 Neuroprotective role of a proline-rich Akt substrate in apoptotic neuronal cell death after stroke: relationships with nerve growth factor.
14755158 2004 Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates.
14735903 2002 Frequent activation of AKT2 kinase in human pancreatic carcinomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699494 2004 Akt2, phosphatidylinositol 3-kinase, and PTEN are in lipid rafts of intestinal cells: role in absorption and differentiation.
14654898 2004 Akt2 expression correlates with prognosis of human hepatocellular carcinoma.
14637151 2003 Akt is an endogenous inhibitor toward tumor necrosis factor-related apoptosis inducing ligand-mediated apoptosis in rheumatoid synovial cells.
14612499 2003 p53 is a determinant of X-linked inhibitor of apoptosis protein/Akt-mediated chemoresistance in human ovarian cancer cells.
14504284 2003 Akt2 negatively regulates assembly of the POSH-MLK-JNK signaling complex.
14500673 2003 Eosinophil major basic protein stimulates neutrophil superoxide production by a class IA phosphoinositide 3-kinase and protein kinase C-zeta-dependent pathway.
12808085 2003 Akt regulates basic helix-loop-helix transcription factor-coactivator complex formation and activity during neuronal differentiation.
12791994 2003 TRB3: a tribbles homolog that inhibits Akt/PKB activation by insulin in liver.
12733712 2003 Increased expression of phosphorylated p70S6 kinase and Akt in papillary thyroid cancer tissues.
12663464 2003 Defective signaling through Akt-2 and -3 but not Akt-1 in insulin-resistant human skeletal muscle: potential role in insulin resistance.
12545160 2003 Downregulation of uPA inhibits migration and PI3k/Akt signaling in glioblastoma cells.
12524439 2003 Identification of a proline-rich Akt substrate as a 14-3-3 binding partner.
12517798 2003 Overexpression of AKT2/protein kinase Bbeta leads to up-regulation of beta1 integrins, increased invasion, and metastasis of human breast and ovarian cancer cells.
12517337 2003 Crystal structure of an inactive Akt2 kinase domain.
12482965 2003 AKT-independent protection of prostate cancer cells from apoptosis mediated through complex formation between the androgen receptor and FKHR.
12480711 2003 Albumin activates the AKT signaling pathway and protects B-chronic lymphocytic leukemia cells from chlorambucil- and radiation-induced apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434148 2002 Crystal structure of an activated Akt/protein kinase B ternary complex with GSK3-peptide and AMP-PNP.
12181350 2002 Cross-linking CD98 promotes integrin-like signaling and anchorage-independent growth.
12176997 2002 Akt forms an intracellular complex with heat shock protein 90 (Hsp90) and Cdc37 and is destabilized by inhibitors of Hsp90 function.
12176337 2002 Identification of a plasma membrane Raft-associated PKB Ser473 kinase activity that is distinct from ILK and PDK1.
12149249 2002 Direct identification of tyrosine 474 as a regulatory phosphorylation site for the Akt protein kinase.
12114503 2002 Elevated Akt phosphorylation as an indicator of renal tubular epithelial cell stress.
12086620 2002 Molecular mechanism for the regulation of protein kinase B/Akt by hydrophobic motif phosphorylation.
11994280 2002 HIV-1-Tat protein activates phosphatidylinositol 3-kinase/ AKT-dependent survival pathways in Kaposi's sarcoma cells.
11988487 2002 Domain mapping studies reveal that the M domain of hsp90 serves as a molecular scaffold to regulate Akt-dependent phosphorylation of endothelial nitric oxide synthase and NO release.
11903042 2002 Platelet-derived growth factor-BB-mediated glycosaminoglycan synthesis is transduced through Akt.
11781143 2002 Ser-474 is the major target of insulin-mediated phosphorylation of protein kinase B beta in primary rat adipocytes.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11546794 2001 Heregulin-dependent activation of phosphoinositide 3-kinase and Akt via the ErbB2/ErbB3 co-receptor.
11507039 2001 Phosphatidylinositol-3-OH Kinase (PI3K)/AKT2, activated in breast cancer, regulates and is induced by estrogen receptor alpha (ERalpha) via interaction between ERalpha and PI3K.
11500317 2001 GLUT-4 translocation in skeletal muscle studied with a cell-free assay: involvement of phospholipase D.
11445557 2001 Regulation of Akt/PKB activation by tyrosine phosphorylation.
11432835 2001 Rsk2 allosterically activates estrogen receptor alpha by docking to the hormone-binding domain.
11313479 2001 Inhibition of nuclear import by protein kinase B (Akt) regulates the subcellular distribution and activity of the forkhead transcription factor AFX.
11278835 2001 Inhibition of insulin-induced activation of Akt by a kinase-deficient mutant of the epsilon isozyme of protein kinase C.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11139588 2001 Phosphatidylinositol 3-kinase/AKT-mediated activation of estrogen receptor alpha: a new model for anti-estrogen resistance.
10983986 2000 The protooncogene TCL1 is an Akt kinase coactivator.
10491192 1999 Molecular cloning, expression and characterization of the human serine/threonine kinase Akt-3.
10490823 1999 Identification of a chromosome 3p14.3-21.1 gene, APPL, encoding an adaptor molecule that interacts with the oncoprotein-serine/threonine kinase AKT2.
9736715 1998 Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.
9528769 1998 pp90rsk1 regulates estrogen receptor-mediated transcription through phosphorylation of Ser-167.
9512493 1998 Activation of protein kinase B beta and gamma isoforms by insulin in vivo and by 3-phosphoinositide-dependent protein kinase-1 in vitro: comparison with protein kinase B alpha.
9394803 1997 Extracellular HIV-1 Tat protein activates phosphatidylinositol 3- and Akt/PKB kinases in CD4+ T lymphoblastoid Jurkat cells.
9374542 1997 Mitogenic activation, phosphorylation, and nuclear translocation of protein kinase Bbeta.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8622988 1996 Amplification of AKT2 in human pancreatic cells and inhibition of AKT2 expression and tumorigenicity by antisense RNA.
3037531 1987 Molecular cloning of the akt oncogene and its human homologues AKT1 and AKT2: amplification of AKT1 in a primary human gastric adenocarcinoma.
1801921 1991 Molecular cloning of a second form of rac protein kinase.
1409633 1992 AKT2, a putative oncogene encoding a member of a subfamily of protein-serine/threonine kinases, is amplified in human ovarian carcinomas.