Property Summary

NCBI Gene PubMed Count 2,317
PubMed Score 18275.33
PubTator Score 8060.70

Knowledge Summary

Patent (545,805)

TINX Plot

  Disease Sources (6)

Disease Target Count Z-score Confidence
Cancer 2346 7.97 4.0
Disease Target Count
Colorectal Cancer 62

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000
See source...

Synonym

Accession P31749 B2RAM5 B7Z5R1 Q9BWB6
Symbols AKT
PKB
RAC
CWS6
PRKBA
PKB-ALPHA
RAC-ALPHA

Gene

PDB

3CQU   3CQW   3MV5   3OW4   3QKK   4EKK   1H10   1UNP   1UNQ   1UNR   2UVM   2UZR   2UZS   3MVH   3O96   3OCB   3QKL   3QKM   4EJN   4EKL   4GV1   5KCV  

  Ortholog (9)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1378 confirmatory 0 / 0 / 18 AKT counterscreen of confirmed PKD inhibitors-57K library
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (2192)

PMID Text
27348973 the RRM2/AKT/NF-kappaB signaling pathway is essential for tumor invasiveness in gastric cancer cells
27098694 Akt has a role in several key steps of peripheral nervous system myelination, including axon wrapping and myelin sheath thickness.
27053161 this study highlights the molecular basis for posttranslational modifications of Gata3 that control the regulation of IFNgamma expression in memory Th2 cells.
27048245 Our study demonstrates that the IGF1R/p110b/AKT/mTOR axis confers resistance to BYL719 in PIK3CA mutant breast cancers.
27010857 findings demonstrate that the BRD7/miR-141/PTEN/AKT axis has critical roles in the progression of NPC and provide some promising targets for the diagnosis and treatment of NPC.
26971877 The Akt pathway controls endothelial Jagged1 expression and, thereby, Notch signalling regulating VSMC maintenance.
26962683 results suggest that IL10-mediated inhibition of autophagy is facilitated by the cross talk between STAT3, AKT, and mTOR; in other words, the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26945151 The Asian-American variant of human papillomavirus type 16 exhibits higher activation of MAPK and PI3K/AKT signaling pathways, transformation, migration and invasion of primary human keratinocytes.
26930065 Studies indicate key feedback loops involved in the cross-talk among the insulin-proto-oncogene protein c-akt (AKT) and MAPK/ERK signaling pathways.
26921108 mediates mitophagy thus contributing to alveolar macrophage apoptosis resistance and pulmonary fibrosis
More...

AA Sequence

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRP      1 - 70
NTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAK     71 - 140
PKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFL    141 - 210
TALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENL    211 - 280
MLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY    281 - 350
NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK    351 - 420
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA              421 - 480
//

Text Mined References (2343)

PMID Year Title
27348973 2016 Overexpression of RRM2 in gastric cancer cell promotes their invasiveness via AKT/NF-?B signaling pathway.
27098694 2016 Akt Regulates Axon Wrapping and Myelin Sheath Thickness in the PNS.
27053161 2016 Akt1-mediated Gata3 phosphorylation controls the repression of IFN? in memory-type Th2 cells.
27048245 2016 Activation of IGF1R/p110?/AKT/mTOR confers resistance to ?-specific PI3K inhibition.
27010857 2016 miR-141 is involved in BRD7-mediated cell proliferation and tumor formation through suppression of the PTEN/AKT pathway in nasopharyngeal carcinoma.
26971877 2016 Stability and function of adult vasculature is sustained by Akt/Jagged1 signalling axis in endothelium.
26962683 2016 IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26945151 2016 The Asian-American variant of human papillomavirus type 16 exhibits higher activation of MAPK and PI3K/AKT signaling pathways, transformation, migration and invasion of primary human keratinocytes.
26930065 2016 Dynamic Modeling and Analysis of the Cross-Talk between Insulin/AKT and MAPK/ERK Signaling Pathways.
26921108 2016 Macrophage Akt1 Kinase-Mediated Mitophagy Modulates Apoptosis Resistance and Pulmonary Fibrosis.
More...