Property Summary

Ligand Count 2
NCBI Gene PubMed Count 42
PubMed Score 65.39
PubTator Score 49.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.021 2.0e-02
acute quadriplegic myopathy 1.258 5.7e-06
Breast cancer 2.300 2.8e-02
colon cancer 2.300 1.0e-02
cutaneous lupus erythematosus 1.200 3.3e-03
dermatomyositis 1.700 2.1e-03
diabetes mellitus -1.100 1.0e-02
invasive ductal carcinoma -1.003 3.0e-04
juvenile dermatomyositis 1.076 1.5e-08
lung adenocarcinoma -1.100 1.1e-06
medulloblastoma, large-cell -1.200 3.0e-04
Multiple myeloma 1.597 1.8e-03
non-small cell lung cancer -1.065 1.1e-17
osteosarcoma 1.404 3.0e-03
ovarian cancer -1.300 1.9e-03
psoriasis 1.500 2.5e-03

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (18)

AA Sequence

MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ      1 - 70
AIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGR     71 - 140
GGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEV    141 - 210
HIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTL    211 - 280
DNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERK    281 - 350
EVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS                           351 - 397
//

Text Mined References (55)

PMID Year Title