Property Summary

NCBI Gene PubMed Count 41
Grant Count 28
R01 Count 20
Funding $3,594,066.5
PubMed Score 64.82
PubTator Score 49.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.597 0.002
cutaneous lupus erythematosus 1.200 0.003
psoriasis 1.500 0.002
osteosarcoma 1.404 0.003
medulloblastoma, large-cell -1.200 0.000
juvenile dermatomyositis 1.551 0.000
acute quadriplegic myopathy 1.602 0.000
non-small cell lung cancer -1.065 0.000
colon cancer 2.300 0.010
active Crohn's disease 1.438 0.002
diabetes mellitus -1.100 0.010
Breast cancer 2.300 0.028
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.003 0.000
ovarian cancer 2.200 0.000
dermatomyositis 1.700 0.002

Gene RIF (17)

PMID Text
25253355 Therefore, we propose that DnaJA1 is co-opted by the influenza A virus to enter the nucleus and to enhance its RNA polymerase activity in an Hsp70 cochaperone-independent manner.
24512202 structure and function of human DNAJA1 and its relationship to pancreatic cancer
24318877 we combined the Hsp70-NEF pairs with cochaperones of the J protein family (DnaJA1, DnaJA2, DnaJB1, and DnaJB4) to generate 16 permutations.
24047968 The expression of HSP40A1 (DNAJA1) inhibits HIV-1 Rev expression at the posttranscriptional levels, leading to the reduction of HIV-1 RNA accumulation
24047968 The expression of HSP40A1 (DNAJA1) inhibits HIV-1 Rev expression at the posttranscriptional levels, leading to the reduction of HIV-1 RNA accumulation
22404213 Knockdown of DnaJ (Hsp40) homolog, subfamily A, member 1 (DNAJA1) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
22343013 Moreover, the levels of DnaJA1 and Hsp70 seem to play against each other with regard to tau: as DnaJA1 levels increase, tau levels are reduced, but this can be prevented if Hsp70 levels are simultaneously induced.
21999493 Hdj2 directly associates with Japanese encephalitis virus nonstructural protein NS5 and facilitates viral replication.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20363747 Hsc70 and a dimer of DjA1 independently bind to an unfolded protein
More...

AA Sequence

MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ      1 - 70
AIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGR     71 - 140
GGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEV    141 - 210
HIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTL    211 - 280
DNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERK    281 - 350
EVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS                           351 - 397
//

Text Mined References (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25281747 2014 RING finger protein RNF207, a novel regulator of cardiac excitation.
25253355 2014 DnaJA1/Hsp40 is co-opted by influenza A virus to enhance its viral RNA polymerase activity.
24512202 2014 Structure and function of human DnaJ homologue subfamily a member 1 (DNAJA1) and its relationship to pancreatic cancer.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
23431407 2013 Distinct roles of molecular chaperones HSP90? and HSP90? in the biogenesis of KCNQ4 channels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22343013 2012 DnaJA1 antagonizes constitutive Hsp70-mediated stabilization of tau.
22085931 2012 Optimal functional levels of activation-induced deaminase specifically require the Hsp40 DnaJa1.
More...