Property Summary

Ligand Count 3,423
NCBI Gene PubMed Count 2,084
PubMed Score 4453.77
PubTator Score 4693.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Alcohol dependence 107 5.656 2.8

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.207 5.0e-03
Breast cancer 1.100 3.2e-02
lung adenocarcinoma -4.000 1.3e-16
lung cancer -1.200 9.4e-03
lung carcinoma -4.500 1.5e-13
non primary Sjogren syndrome sicca -1.500 2.4e-02
non-small cell lung cancer -2.014 1.6e-14
osteosarcoma 1.113 1.2e-04

Gene RIF (2552)

AA Sequence

METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTL      1 - 70
VAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALG     71 - 140
QYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCT    141 - 210
NYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKV    211 - 280
VWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASY    281 - 350
NKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS    351 - 420
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVK    421 - 490
LLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSP    491 - 560
PQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV    561 - 630
//

Text Mined References (2086)

PMID Year Title