Property Summary

Ligand Count 499
NCBI Gene PubMed Count 43
PubMed Score 34.20
PubTator Score 34.56

Knowledge Summary

Patent (1,273)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Schizoaffective Disorder 55 0.0 5.0
Disease Target Count Z-score Confidence
Angelman syndrome 34 5.322 2.7
Prader-Willi syndrome 48 4.96 2.5

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.500 1.5e-02
astrocytic glioma -3.700 3.6e-03
Astrocytoma, Pilocytic -4.000 1.9e-04
atypical teratoid / rhabdoid tumor -2.600 8.3e-03
Breast cancer -3.000 1.3e-02
ependymoma -3.400 3.7e-02
glioblastoma -3.400 5.8e-05
group 4 medulloblastoma -2.700 4.4e-02
Hydrolethalus syndrome -2.421 2.2e-02
medulloblastoma, large-cell 1.700 3.4e-02
oligodendroglioma -2.900 3.2e-02
Pick disease -2.400 1.4e-02
primitive neuroectodermal tumor -3.400 2.9e-02

Gene RIF (33)

AA Sequence

MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGE      1 - 70
RITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKK     71 - 140
SIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGST    141 - 210
KSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFW    211 - 280
LNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWA    281 - 350
WDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYN    351 - 420
SISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK                                421 - 462
//

Text Mined References (44)

PMID Year Title