Property Summary

NCBI Gene PubMed Count 42
PubMed Score 32.66
PubTator Score 34.56

Knowledge Summary

Patent (1,273)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
glioblastoma multiforme 347 4.9891935863889E-36
oligodendroglioma 2849 2.94304311381087E-24
astrocytoma 1493 6.26749571745932E-5
pilocytic astrocytoma 3086 1.8000806181434E-4
medulloblastoma 1524 0.00334812949088303
atypical teratoid / rhabdoid tumor 4369 0.00832423868957464
Breast cancer 3099 0.0134199535826081
Pick disease 1893 0.0139781605799141
adult high grade glioma 2148 0.0146516331512172
Hydrolethalus syndrome 128 0.0222045377471492
primitive neuroectodermal tumor 3031 0.0286673802792819
medulloblastoma, large-cell 6234 0.0339482007473677
ependymoma 2514 0.0368524291817543

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -4.500 0.000
ependymoma -3.400 0.037
oligodendroglioma -4.500 0.000
glioblastoma multiforme -4.700 0.000
medulloblastoma -3.600 0.003
atypical teratoid / rhabdoid tumor -2.600 0.008
medulloblastoma, large-cell 1.700 0.034
primitive neuroectodermal tumor -3.400 0.029
Hydrolethalus syndrome -2.421 0.022
adult high grade glioma -3.500 0.015
pilocytic astrocytoma -4.000 0.000
Breast cancer -3.000 0.013
Pick disease -2.400 0.014

Synonym

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

Susumu Tomita Biochemical interactoin

Gene RIF (32)

PMID Text
26169564 Report benzodiazepine derivative as GABA-site inhibitor of extra-synaptic GABAA alpha5 receptors.
25663431 Study found that a significant portion of GABAergic postsynaptic compartments contain the alpha5 GABAAR subunit, both in vitro and in vivo
25660468 This study showed that in male groups, the expression of GABRA5 was generally lower in schizophrenia cases compared to the control.
25613138 The gene expression of gamma-aminobutyric acid A receptor alpha 5 subunit is significantly upregulated in clade B Tat treated SK-N-MC neuroblastoma cells
25211390 1,2-dichlorohexafluorocyclobutane enhancement of GABRA5 activity is abolished by GABRB3 mutations.
24755890 Findings provide genetic evidence for the involvement of the genes GABRB3 and GABRA5 in the susceptibility to panic disorder
24227714 The alpha5 nicotinic receptor GABAergic neurons form a link from the medial habenula to the serotonergic brain centers.
22546616 These results provide initial evidence of a GABAA alpha5 deficit in autism spectrum disorder and support further investigations of the GABA system in this disorder.
21751815 Data indicate the selectivity of some selected compounds were assessed in recombinant alpha(1)beta(2)gamma(2)L, alpha(2)beta(1)gamma(2)L, and alpha(5)beta(2)gamma(2)L GABA(A) receptors.
20843900 In subjects with schizophrenia, mean GABA (A) alpha5 rerceptor subunit mRNA expression is 15% lower in layer 4 of the dorsolateral prefrontal cortex.
More...

AA Sequence

MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGE      1 - 70
RITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPLNNLLASKIWTPDTFFHNGKK     71 - 140
SIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDFPMDAHACPLKFGSYAYPNSEVVYVWTNGST    141 - 210
KSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFW    211 - 280
LNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWA    281 - 350
WDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYN    351 - 420
SISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK                                421 - 462
//

Text Mined References (43)

PMID Year Title
26169564 2015 A novel GABA(A) alpha 5 receptor inhibitor with therapeutic potential.
25663431 2015 Synaptic localization of ?5 GABA (A) receptors via gephyrin interaction regulates dendritic outgrowth and spine maturation.
25660468 2015 Sex differences in GABAergic gene expression occur in the anterior cingulate cortex in schizophrenia.
25211390 2014 Enhancement of ?5-containing ?-aminobutyric acid type A receptors by the nonimmobilizer 1,2-dichlorohexafluorocyclobutane (F6) is abolished by the ?3(N265M) mutation.
24755890 2014 Evidence for linkage and association of GABRB3 and GABRA5 to panic disorder.
24227714 2013 Medial habenula output circuit mediated by ?5 nicotinic receptor-expressing GABAergic neurons in the interpeduncular nucleus.
22546616 2013 The brain GABA-benzodiazepine receptor alpha-5 subtype in autism spectrum disorder: a pilot [(11)C]Ro15-4513 positron emission tomography study.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21751815 2011 New insight into the central benzodiazepine receptor-ligand interactions: design, synthesis, biological evaluation, and molecular modeling of 3-substituted 6-phenyl-4H-imidazo[1,5-a][1,4]benzodiazepines and related compounds.
20843900 2011 Lamina-specific alterations in cortical GABA(A) receptor subunit expression in schizophrenia.
More...