Property Summary

NCBI Gene PubMed Count 45
PubMed Score 269.97
PubTator Score 94.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count P-value
lung carcinoma 2844 6.8560027369473E-34
posterior fossa group B ependymoma 1530 8.96016639658144E-8
ulcerative colitis 2087 8.58248710063271E-7
ovarian cancer 8492 1.65106182532835E-5
malignant mesothelioma 3163 2.36312895419303E-5
acute quadriplegic myopathy 1157 4.19227420520723E-5
medulloblastoma, large-cell 6234 9.09230693075663E-5
interstitial cystitis 2299 1.04357323269943E-4
atypical teratoid / rhabdoid tumor 4369 1.59429979573613E-4
tuberculosis and treatment for 3 months 327 3.58354374918598E-4
adrenocortical carcinoma 1427 4.25646696790487E-4
invasive ductal carcinoma 2950 5.21455827216466E-4
primary pancreatic ductal adenocarcinoma 1271 5.50244511785445E-4
ductal carcinoma in situ 1745 7.43687360398801E-4
psoriasis 6685 9.97889212335081E-4
active Crohn's disease 918 0.00100742928480676
nasopharyngeal carcinoma 1056 0.00184803360232013
COPD 116 0.00203356511961515
osteosarcoma 7933 0.00276136390288004
group 4 medulloblastoma 1875 0.00407854564765389
pancreatic cancer 2300 0.00651492660008239
Gaucher disease type 3 76 0.00779716494815406
colon cancer 1475 0.0142708312652599
lung cancer 4473 0.0143221328678048
oligodendroglioma 2849 0.0272996460438534
gastric cancer 436 0.03299973911976
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0465104570743253

Expression

Synonym

Accession P31641 B2RNU7 Q9BRI2 Q9BXB0
Symbols TAUT

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (24)

PMID Text
26206726 CNDP1 and CARNS are expressed in glomeruli and tubular cells; TauT is expressed in renal epithelial cells; CDNP1 may have a role in diabetic neuropathy
25501278 This is the first study to present information on the transcriptional regulation of taurine transporter gene and the localization of the taurine transporter protein in chondrocytic cells.
24866236 Immunocytochemistry and flow cytometry analyses revealed that these mAbs recognized the native form of the extracellular domain of SLC6A6 on the cell surface.
24842606 Neurotransmitter transporters including SLC6A6 and SLC6A13 mediate the uptake of 5-aminolevulinic acid (ALA) and can play roles in the enhancement of ALA-induced accumulation of protoporphyrin in cancerous cells.
23519128 Taurine transporter deficiency results in aberrant trophoblast turnover and fetal growth restriction.
23392892 Knockdown of TauT impairs kidney development, possibly through regulation of cell cycle-related genes.
23392891 Expression of TauT is differentially regulated by Vitamin D(3) and retinoic acid via formation of VDR and RXR complexes in the nuclei in a cell type-dependent manner.
23392873 Syncytiotrophoblast TauT activity is reduced in maternal obesity and pre-eclampsia compared to normal pregnancy.
23180277 Taurine transporter is a novel pathological marker for stressed motor neurons in amyotrophic lateral sclerosis.
21739148 TauT gene is overexpressed in peripheral blood mononuclear cells of type 2 diabetic patients.
More...

AA Sequence

MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYL      1 - 70
CYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIV     71 - 140
ILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGI    141 - 210
DHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYP    211 - 280
DITRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGF    281 - 350
MAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS    351 - 420
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYD    421 - 490
GIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPNWAIGLGWSLALSSMLCVPLV    491 - 560
IVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNSRTVMNGALVKPTHIIVETMM              561 - 620
//

Text Mined References (48)

PMID Year Title
26206726 2015 Intrinsic carnosine metabolism in the human kidney.
25501278 2015 Chondrocytic cells express the taurine transporter on their plasma membrane and regulate its expression under anisotonic conditions.
24866236 2014 Immunization method for multi-pass membrane proteins using highly metastatic cell lines.
24842606 Neurotransmitter transporter family including SLC6A6 and SLC6A13 contributes to the 5-aminolevulinic acid (ALA)-induced accumulation of protoporphyrin IX and photodamage, through uptake of ALA by cancerous cells.
23519128 2013 Taurine transport in human placental trophoblast is important for regulation of cell differentiation and survival.
23392892 2013 Knockdown of TauT expression impairs human embryonic kidney 293 cell development.
23392891 2013 Differential regulation of TauT by calcitriol and retinoic acid via VDR/RXR in LLC-PK1 and MCF-7 cells.
23392873 2013 Reduced placental taurine transporter (TauT) activity in pregnancies complicated by pre-eclampsia and maternal obesity.
23180277 2013 Expression of taurine transporter (TauT) is modulated by heat shock factor 1 (HSF1) in motor neurons of ALS.
23006423 2012 Genetic association with overall survival of taxane-treated lung cancer patients - a genome-wide association study in human lymphoblastoid cell lines followed by a clinical association study.
More...