Property Summary

NCBI Gene PubMed Count 46
PubMed Score 305.71
PubTator Score 94.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 1.355 1.0e-03
active ulcerative colitis 1.495 2.4e-03
acute quadriplegic myopathy 1.655 4.2e-05
adrenocortical carcinoma -1.453 4.3e-04
atypical teratoid / rhabdoid tumor 1.400 1.6e-04
colon cancer 2.300 7.7e-03
COPD -1.500 2.0e-03
ductal carcinoma in situ 1.200 7.4e-04
ependymoma -1.500 2.9e-02
gastric cancer -1.200 3.3e-02
Gaucher disease type 3 -1.300 7.8e-03
group 4 medulloblastoma 1.600 4.1e-03
interstitial cystitis 1.100 7.0e-03
intraductal papillary-mucinous neoplasm ... 2.600 4.7e-02
invasive ductal carcinoma 2.116 5.2e-04
lung cancer 1.200 1.4e-02
lung carcinoma -2.700 6.9e-34
malignant mesothelioma 1.100 2.4e-05
medulloblastoma, large-cell 2.100 9.1e-05
nasopharyngeal carcinoma -1.100 1.8e-03
oligodendroglioma -1.100 2.7e-02
osteosarcoma -1.355 2.8e-03
ovarian cancer -1.900 1.7e-05
pancreatic cancer 1.700 1.1e-04
pancreatic ductal adenocarcinoma liver m... 1.260 4.2e-02
psoriasis -1.600 1.0e-03
tuberculosis and treatment for 3 months -1.100 3.6e-04

Gene RIF (26)

AA Sequence

MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVGLGNVWRFPYL      1 - 70
CYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLFSGIGYASVVIVSLLNVYYIV     71 - 140
ILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNKSVWITISSTNFTSPVIEFWERNVLSLSPGI    141 - 210
DHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYP    211 - 280
DITRLEDPQVWIDAGTQIFFSYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGF    281 - 350
MAQEQGVDIADVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS    351 - 420
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIAWIYGGDNLYD    421 - 490
GIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPNWAIGLGWSLALSSMLCVPLV    491 - 560
IVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNSRTVMNGALVKPTHIIVETMM              561 - 620
//

Text Mined References (49)

PMID Year Title