Property Summary

NCBI Gene PubMed Count 35
Grant Count 61
R01 Count 48
Funding $6,005,576.25
PubMed Score 520.14
PubTator Score 586.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -1.160 0.001

Synonym

Accession P31639 A2RRD2 Na(+)/glucose cotransporter 2
Symbols SGLT2

Gene

PANTHER Protein Class (2)

Gene RIF (27)

PMID Text
26735923 Mutations in the SLC5A2 gene did not find any evidence that chronic loss of glucose in the urine would protect from deterioration of the glucose tolerance over time.
26403227 Data suggest that SGLT2 plays central role in energy metabolism and renal elimination of circulating glucose; targeted inhibition of SGLT2 alters energy metabolism in diabetes and obesity.
26362302 Data suggest that SGLT2 is transporter found in proximal renal tubules, responsible for reabsorption of most of glucose filtered by kidney; inhibition of SGLT2 lowers blood glucose level by promoting urinary excretion of excess glucose. [REVIEW]
26260238 Data show that thiosugars bind to sodium-glucose co-transporters vSGLT and hSGLT2 stronger and dissociate more slowly than sugars.
26170283 SGLT2 is functionally expressed in pancreatic and prostate adenocarcinomas
25894829 SGLT2 is inhibited with dapagliflozin in pancreatic alpha cells, which triggers glucagon secretion
25345427 SGLT2 inhibitor canagliflozin can be coadministered with oral contraceptives, warfarin, or digoxin without dose adjustments.
25339128 Results identified six SLC5A2 variants including four novel variants in Chinese familial renal glucosuria. Variant SLC5A2 proteins had altered expression levels and patterns in addition to significantly lower glucose transport in cultured cells.
25110280 A single dose of canagliflozin, a sodium glucose co-transporter 2 inhibitor, 300 mg reduced both fasting and postprandial PG.
23714218 Studies indcate that glucose is present in the glomerular filtrate and is reabsorbed by a group of transport proteins in the renal tubular epithelium, with sodium glucose transporter (SGLT)-2 quantitatively the most important.
More...

AA Sequence

MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGAS      1 - 70
LFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRL     71 - 140
YLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVILG    141 - 210
GACILMGYAFHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALL    211 - 280
LGLTIVSGWYWCSDQVIVQRCLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEV    281 - 350
CRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR    351 - 420
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLI    421 - 490
GGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAPIPRKHLHRLV    491 - 560
FSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQAPAPSLFRQCLLWFCGMSRGGVGSPPPLTQ    561 - 630
EEAAAAARRLEDISEDPSWARVVNLNALLMMAVAVFLWGFYA                                631 - 672
//

Text Mined References (37)

PMID Year Title
26735923 2016 Influence of Familial Renal Glycosuria Due to Mutations in the SLC5A2 Gene on Changes in Glucose Tolerance over Time.
26403227 2016 Energy balance and metabolic changes with sodium-glucose co-transporter 2 inhibition.
26362302 2016 SGLT2 inhibitors.
26260238 2015 Binding interaction of SGLT with sugar and thiosugar by the molecular dynamics simulation.
26170283 2015 Functional expression of sodium-glucose transporters in cancer.
25894829 2015 Inhibition of the glucose transporter SGLT2 with dapagliflozin in pancreatic alpha cells triggers glucagon secretion.
25345427 2015 Effect of canagliflozin, a sodium glucose co-transporter 2 inhibitor, on the pharmacokinetics of oral contraceptives, warfarin, and digoxin in healthy participants.
25339128 2015 Novel SLC5A2 variants contribute to renal glucosuria in Chinese families: abnormal expression and dysfunction of variant SLC5A2.
25110280 2014 Canagliflozin, a sodium glucose co-transporter 2 inhibitor, reduces post-meal glucose excursion in patients with type 2 diabetes by a non-renal mechanism: results of a randomized trial.
23714218 2013 Sodium glucose transporter 2 inhibition: a new approach to diabetes treatment.
More...